KEGG   Caenorhabditis elegans (nematode): CELE_F32H2.9Help
Entry
CELE_F32H2.9      CDS       T00019                                 

Gene name
tba-6
Definition
(RefSeq) Tubulin alpha chain
  KO
K07374  tubulin alpha
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04145  Phagosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    CELE_F32H2.9 (tba-6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cel03019]
    CELE_F32H2.9 (tba-6)
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_F32H2.9 (tba-6)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cel04812]
    CELE_F32H2.9 (tba-6)
   04147 Exosome [BR:cel04147]
    CELE_F32H2.9 (tba-6)
Messenger RNA biogenesis [BR:cel03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     CELE_F32H2.9 (tba-6)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     CELE_F32H2.9 (tba-6)
Cytoskeleton proteins [BR:cel04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    CELE_F32H2.9 (tba-6)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_F32H2.9 (tba-6)
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_F32H2.9 (tba-6)
  Exosomal proteins of colorectal cancer cells
   CELE_F32H2.9 (tba-6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Motif
Other DBs
NCBI-GeneID: 172717
NCBI-ProteinID: NP_492419
WormBase: WBGene00006532
Ensembl: WBGene00006532
UniProt: P91873
LinkDB All DBs
Position
I:join(8994051..8994071,8994714..8994936,8994980..8995101,8995256..8995569,8997468..8997582,8997737..8997996,8998050..8998148,8998196..8998293,8998391..8998533)
Genome map
AA seq 464 aa AA seqDB search
MPQYKGSREVISIHVGQAGVQIGNACWELFCLEHGIQPDGYHVEDDTYDEETETINTFFA
ETAGGKHVPRCLFVDLEPTVVDEVRTGTYRSLFHPEQLLSGKEDAANCYARGRYTIGREM
IDVVMDRVKRLAENCNGLQGFVIFHSFGGGTGSGFLSLLMERLSTEYGKKPKLEFAIYPA
PQVSTSMVEPYNSILMTHTTLEHSDCTFMVDNEAIYDICRRNLDLARPTYTNLNRLVAQI
ISSITASLRFEGALNVDLTEFQTNLVPYPRIHFPLVTYAPLVSAERASHEQNTVSDMTHA
CFEPGYQMVKCDPRRGKYMAVCLLYRGDVVPKDINSAIAAVKTKRTVQFVEWCPTGFKVG
INYQPPTVVPGGDLGKQTRSVCMISNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGME
EGEFSEAREDMAALEKDYEEIGEDELPDDIDDQSYRGRSSGSRY
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgccacaatacaaaggaagtcgcgaagtaatatcaatccacgtgggtcaagcaggagtt
cagattggaaatgcgtgttgggaactgttttgtctggaacacggaatacagcccgatggt
taccatgttgaagatgacacttatgatgaagaaactgagacaattaacactttcttcgca
gagaccgctggtgggaaacacgttccacgttgcctttttgtcgatttggaaccaactgtc
gttgacgaagttcgcactggaacataccgaagtcttttccatccggaacagcttttgtct
ggaaaagaagatgcagctaattgttatgcaagaggaagatatacaattggaagagaaatg
attgatgtagtcatggaccgtgttaagcgtcttgcagagaactgcaatggacttcaagga
tttgtaatatttcattcatttggaggaggaactggatctggttttctatcacttttgatg
gaaagattatcaacggaatacggaaagaagccaaagctagaatttgctatatatccagct
ccacaagtatctacatcaatggtagaaccatataactcaattctaatgacacatacaaca
ctagagcactctgattgtacttttatggttgataacgaggcaatttacgacatttgcaga
agaaatttggatctagcaagaccaacctacacaaatttgaatcgtttggtggctcaaatc
atcagctcaattacagcttctcttcgtttcgaaggtgctctcaatgttgatctaactgag
ttccaaacaaatctcgttccgtatccacgtattcatttcccattagtcacatatgctcca
cttgtatctgctgaacgtgcttctcatgagcagaatacagtctctgatatgacacatgca
tgctttgaaccagggtatcaaatggtcaagtgtgatccaagaagaggaaaatatatggca
gtgtgcctgctgtatcgtggtgatgttgtaccaaaagatatcaactcagcaattgcagct
gtaaagacaaaacggacagttcaatttgttgaatggtgtccaaccggtttcaaagttggc
atcaactatcaaccaccaacagttgttccgggtggagatttgggaaaacagacaagaagt
gtttgtatgatcagtaatactactgctatcgccgaagcatgggctcggctcgatcataaa
tttgacttgatgtatgcaaaacgtgcttttgtgcactggtatgttggagaaggaatggaa
gaaggcgaattctcagaagccagggaggatatggctgctctcgaaaaagattacgaagag
attggggaagacgagcttccagatgacattgacgatcaatcgtatcgaggaagaagctca
gggtcccgatattaa

DBGET integrated database retrieval system