KEGG   Caenorhabditis elegans (nematode): CELE_F33E2.2
Entry
CELE_F33E2.2      CDS       T00019                                 

Gene name
dlk-1
Definition
(RefSeq) Mitogen-activated protein kinase kinase kinase dlk-1
  KO
K04422  mitogen-activated protein kinase kinase kinase 13 [EC:2.7.11.25]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_F33E2.2 (dlk-1)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_F33E2.2 (dlk-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_F33E2.2 (dlk-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     CELE_F33E2.2 (dlk-1)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: TKL group
  MLK family
   CELE_F33E2.2 (dlk-1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RIO1 Kdo Pkinase_fungal FTA2 Integrin_b_cyt
Other DBs
NCBI-GeneID: 173128
NCBI-ProteinID: NP_001021444
WormBase: WBGene00001008
Ensembl: WBGene00001008
UniProt: O01700
LinkDB
Position
I:complement(join(12566129..12566218,12566721..12567376,12568206..12568365,12568457..12568617,12569008..12569389,12569518..12569827,12569935..12570084,12570181..12570678,12570725..12570884,12571429..12571575,12572745..12572796))
AA seq 921 aa
MTSTTMVTTLDLVTPTSEEQPGPAPESSDFSTVVLSPDGSELVTQSAPNTPIQHREQANA
EFGQKEGSPDPKNMVAATGNASKPSLNSFYADGLGQLRNGLFSCFQPVFGYFGTKTTVEI
EKSEDELWEIPFDAISELEWLGSGSQGAVFRGQLENRTVAVKKVNQLKETEIKHLRHLRH
QNIIEFLGVCSKSPCYCIVMEYCSKGQLCTVLKSRNTITRELFAQWVKEIADGMHYLHQN
KVIHRDLKSPNILISAEDSIKICDFGTSHMQKKMDSTMMSFCGTVSWMAPEMIKKQPCNE
KVDVYSFGVVLWEMLTRETPYANIAQMAIIFGVGTNILSLPMPEEAPKGLVLLIKQCLSQ
KGRNRPSFSHIRQHWEIFKPELFEMTEEEWQLAWDSYREFAKCIQYPSTVTRDHGGPKSA
FAMEEEIQRKRHEQLNHIKDIRNMYEMKLKRTNKMYDKLQGCFTELKLKESELAEWEKDL
TEREQWHNQNSPKAVAAPRAQLRGYPNEGYDDMSSDEDVQPCRGSPYRCSNTSSSSGVQS
SPFSRQSSSRSSAGQQTRRSEGANPPKILRNDAIRHSGSYWETLGGARGSPARDSGFSQD
SGMWSAGAGSCTAINGGGQQVCYSQTLYRNGDGRWSDGRIASRRRVSTSVNKSTAVPGQP
VFFTRDSPSRVPHARSSSKLNRSSYPSRNAPHQLEDGCCCAHARAPRAKSIAVPMTSSSR
ARSPTPYDNDFENAESFVDPESPKNLKNLEKIVNLPESTSYDEALCNSDVTMNPIYTSPI
TTYSNPCHVELVDEENANDVDLTSSMDSRRSRSDDADVESSEEDEGNGNNILNTSMESED
LRYRIDTSQSTMMSSLERSLEIGATRSDGLSDNEMRVQAVKMSIKTHRRTGSNPQALIHQ
CIDEYTTSATDDSDDAGAVRI
NT seq 2766 nt   +upstreamnt  +downstreamnt
atgacatctaccacaatggtaaccactctcgacttggtcacaccaacatcagaagaacaa
ccgggtcctgcaccggagtcctccgacttctctacagtagtcctgagtccggatgggtcg
gagcttgtgacacaaagtgctccaaacacaccgatacagcatcgggagcaggcgaacgcg
gagttcggacagaaagaaggatccccagatcccaaaaatatggtggctgcgaccgggaac
gcgtcgaaacccagcctgaacagcttctacgcagatgggctcggacagcttaggaatggg
ctcttttcgtgttttcagccagtttttggatatttcgggactaaaactacagttgaaatt
gaaaaatccgaggatgaactatgggagatcccattcgacgctatctccgaacttgaatgg
ctgggctccgggagccagggagcagtgtttcgtggtcagctggaaaaccgaactgtcgct
gtgaaaaaggtcaatcaactgaaggagaccgagatcaagcatcttcgacatctccgtcac
cagaatatcattgaatttctcggagtttgctcaaagagcccgtgctactgtatagtgatg
gaatattgctcaaaaggacaactatgtactgtattgaagtcaagaaatacaataacccga
gaactttttgctcaatgggttaaggaaattgctgatggaatgcactatttgcatcagaac
aaagtgatccacagggatctcaaatcgcccaatattctaatctccgctgaagattcaatt
aaaatttgtgattttggaacgtctcatatgcaaaagaaaatggatagtactatgatgtca
ttctgtggaactgttagctggatggccccagaaatgataaaaaaacagccatgcaacgaa
aaagtcgacgtctactcatttggagttgtgctctgggagatgctcaccagagagacgcca
tacgcaaatattgctcagatggcaatcatttttggtgttggaacaaacattctgagcctt
ccaatgccagaagaagctccgaaaggtcttgtacttctcatcaagcaatgtctatctcaa
aaaggtcgcaatcgtccctcattctcccacatccgacaacactgggagatcttcaagccg
gaacttttcgaaatgactgaagaggagtggcagttggcatgggattcttacagagagttc
gcgaaatgtatacagtatccgtctacagtaaccagggatcatggtggaccgaaaagcgca
tttgcgatggaggaggaaatacagaggaagcggcatgagcaattgaatcatattaaggac
atccgaaatatgtacgagatgaagcttaaacgaaccaacaaaatgtatgacaaactccaa
ggctgcttcacagagctgaaactcaaggaaagtgagctcgccgagtgggaaaaagatctg
actgaacgggagcagtggcacaatcagaacagcccgaaggcagtggcggctccgcgagca
cagctacgtggatacccgaatgagggatatgatgatatgtcgtctgacgaagatgttcaa
ccgtgccgaggatctccgtataggtgctccaatacgagctcctcgtcaggagttcagagc
tctccgttctcaaggcaaagctcgagccggagcagtgctggacagcaaacgaggagaagc
gagggagcgaatccgccaaaaatcctacgcaacgacgccatacgtcattcagggtcctac
tgggagacgctgggtggggcccgtggatcaccggccagggattccggattttctcaggat
tccgggatgtggagcgctggagccggtagctgcacagctattaatggtggaggacaacag
gtttgctactcccaaactctgtaccgtaacggtgacggtcgctggtcggacgggcgcata
gcttcacgtcggagggtctccacgtcagtcaacaagtcaactgcagtccccggacagccc
gtcttctttacacgtgacagcccgtcacgtgtcccacacgcccgttcaagctcaaagctc
aaccgttcatcctatccatctcgaaatgctcctcaccagctcgaagacggctgctgctgt
gctcacgcccgtgctccgcgagcaaaatcaattgctgtgccgatgacgtcatcatctaga
gcccggagcccaactccatatgacaatgattttgaaaatgccgagagcttcgtggatccg
gaatctccgaaaaatttgaaaaatttggaaaaaatcgtaaacttgccagagtccacgtcc
tacgacgaggctttatgcaatagtgatgtgacaatgaacccgatttacacgtcaccaatc
accacctacagtaacccgtgccacgtggagctggtggacgaggaaaacgcaaatgacgtg
gatctgacgtcatcgatggattcccgacgatcccgctccgacgatgctgatgttgaatct
tcggaagaagatgagggaaatggaaataatattctgaatacttctatggaatctgaggat
cttcgatatcgaattgacacgtctcagagtactatgatgagctcattggagagaagtctg
gaaattggagccacccggtccgatgggcttagtgataatgagatgagagttcaggcggtc
aaaatgagcatcaaaacgcacaggagaaccggatcgaatccacaagccctaatccaccaa
tgcatcgacgaatacaccacctctgcaacagatgatagtgacgatgccggagcagtccga
atttaa

DBGET integrated database retrieval system