KEGG   Caenorhabditis elegans (nematode): CELE_F36A2.6
Entry
CELE_F36A2.6      CDS       T00019                                 
Symbol
rps-15
Name
(RefSeq) 40S ribosomal protein S15
  KO
K02958  small subunit ribosomal protein S15e
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CELE_F36A2.6 (rps-15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cel03011]
    CELE_F36A2.6 (rps-15)
Ribosome [BR:cel03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    CELE_F36A2.6 (rps-15)
SSDB
Motif
Pfam: Ribosomal_S19
Other DBs
NCBI-GeneID: 172693
NCBI-ProteinID: NP_492384
WormBase: WBGene00004484
Ensembl: WBGene00004484
UniProt: Q9XVP0
LinkDB
Position
I:complement(8815572..8816193)
AA seq 151 aa
MATQDDAHLAELKKKRTFRKFMYRGVDLDQLLDMSREQFTKLLPCRMRRRLDRGLKRKHL
ALIAKVQKAKKAAGVLEKPATVKTHLRDMIILPELVGGVIGIYNGKVFNQTEIKPEMIGF
YLGEFAISYKPVKHGRPGIGATHSSRFIPLK
NT seq 456 nt   +upstreamnt  +downstreamnt
atggctactcaagatgatgcccatctcgctgagctgaagaagaagagaactttccgcaag
ttcatgtacagaggagttgacttggaccaacttttggacatgtcccgtgaacaattcacc
aagcttctcccctgccgcatgcgcagacgtctcgatcgcggactcaagagaaagcacttg
gctctcatcgctaaggtccaaaaggccaagaaggctgctggtgttctcgagaagccagcc
accgttaagacccatctccgagacatgatcatccttccagagctcgttggtggagtcatc
ggaatctacaacggaaaggttttcaaccagaccgaaatcaagccagagatgatcggattc
tatctcggagagttcgctatctcctacaagcctgtcaagcacggaagaccaggtattgga
gctacccactcttcccgattcatcccactcaagtaa

DBGET integrated database retrieval system