KEGG   Caenorhabditis elegans (nematode): CELE_F37C12.7
Entry
CELE_F37C12.7     CDS       T00019                                 

Symbol
acs-4
Name
(RefSeq) fatty Acid CoA Synthetase family
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00061  Fatty acid biosynthesis
cel00071  Fatty acid degradation
cel01100  Metabolic pathways
cel01212  Fatty acid metabolism
cel04146  Peroxisome
Module
cel_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CELE_F37C12.7 (acs-4)
   00071 Fatty acid degradation
    CELE_F37C12.7 (acs-4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CELE_F37C12.7 (acs-4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cel01004]
    CELE_F37C12.7 (acs-4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_F37C12.7 (acs-4)
Enzymes [BR:cel01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     CELE_F37C12.7 (acs-4)
Lipid biosynthesis proteins [BR:cel01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   CELE_F37C12.7 (acs-4)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   CELE_F37C12.7 (acs-4)
  Exosomal proteins of breast cancer cells
   CELE_F37C12.7 (acs-4)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C RHH_1
Other DBs
NCBI-GeneID: 176005
NCBI-ProteinID: NP_498568
WormBase: WBGene00018152
Ensembl: WBGene00018152
UniProt: Q20121
LinkDB
Position
III:join(7167838..7167891,7167960..7168106,7168154..7168243,7168321..7169100,7169150..7170107,7170187..7170353)
AA seq 731 aa
MKRKVSVYDSSKDKTLGQVVKGESPIWIRVAMAILRVWFFIYDCLNYLPYQLFNSPTEKL
RKSERVKANWVDDRDGPIRNIQGHASETFPGKDTVDKVWRKCVELYDESPCLGTRQLIEV
HEDKQPGGRVFEKWHLGEYVWQSYKEVETQVARLAAGIKDLAHEEQNPKVVIFAETRADW
LITALACFRANVTIVTVYATLGEDAIAHAIGETEATILVTSSELLPKIVTLGKKCPTLKT
LIYFAPVDQKAPAPELAPFRDQFKHVLSLSGLLTRNQEQVKESTAVKSDIALIMYTSGTT
GQPKGVILLHQNVVAALLGQGDGVGIICNADTYIGYLPLAHILELDAELTCLTKGAKVGY
SSPLTLHDRASKIQKGTHGDCHALRPTLMAAVPAIMDRIFKAVSEEVAASPRFMQELFKL
NYERKRSRYLEGYCSPFLDRIVFKKIRRLLGGKLRGVLSGGAPLNAETQRFMNICMCCPV
VQGYGLTETCGAACVADINDLSTGTVGPPVRCSDIALREWSEGGYSPFNDPPQGEILISG
ENISPGYYKQPEKTAEDFITYKGKVYFATGDIGQKRDDGSLLIIDRKKDLVKLQHGEYVS
LAKVECALLNCPIVDNICVYGSGMEDSVVALVVPNQKHLEKIAEAEGVSTSEMKTMCEDK
KVIAAYKKQLEEHAKKSKLSRSEIPAAIHLCPEIWTPDTGLLTEALKLKRKPIQMAYQKT
LDDLYKQLKKN
NT seq 2196 nt   +upstreamnt  +downstreamnt
atgaaacggaaagtttcggtatacgattcttcaaaggataagacactcggccaggtagtg
aaaggtgaatcaccaatatggattcgtgtagctatggccatccttcgtgtgtggtttttc
atatacgattgtctcaactacttgccataccagttgttcaattcgccaacggaaaagctt
cggaagtcggagcgagtaaaggcaaattgggttgacgatcgtgatggaccaatccgtaat
attcaaggacatgcttcagaaacattcccaggaaaagacacagttgataaggtttggaga
aagtgcgtcgaactctacgatgaatcgccatgtttgggaactcgacagcttattgaagtt
cacgaagataaacaacctggaggccgtgtgtttgagaagtggcatcttggagagtatgtg
tggcagagctacaaagaagttgaaactcaagtcgcccgcctcgcagccggtatcaaggat
cttgcccatgaagaacaaaatccgaaagttgttatctttgctgaaactcgtgcagattgg
ctcatcactgctcttgcctgtttccgtgccaacgtcaccatcgtaactgtatacgcaact
ttgggagaagacgcaattgctcatgccatcggagagactgaagctacaattcttgtcact
tcttcggaacttcttccaaagattgtaacgcttggaaagaaatgtccaactctgaagacc
ctgatttatttcgctcctgtggaccagaaagcaccagcaccagagcttgcaccgttccgt
gatcagttcaaacatgttctatcactgagcggacttcttactcgcaatcaggaacaagtt
aaagaatctacagctgtgaagtcagacattgccctcatcatgtacacttctggcacaact
ggtcagccaaaaggagttattcttcttcatcaaaacgttgtggctgctttgttgggacaa
ggggatggtgttggaatcatatgcaatgcagatacatacattgggtatcttccacttgct
catattctcgaattggatgccgaattgacatgtttgactaaaggagccaaggttggatat
tcttcacccttgacacttcacgaccgtgcatcaaaaatccaaaagggaacacatggagat
tgtcatgccctccgcccaactcttatggctgctgttccagctattatggatcgaattttc
aaggccgtctccgaagaagttgctgcatcacctcgtttcatgcaagaattgttcaaactt
aattatgagagaaagagatcccgctatttggagggttactgcagtccattccttgatcgc
atcgtattcaaaaagattcgcagacttttgggaggaaaacttcgtggtgttttgtctggt
ggagccccattgaacgctgaaactcaaagattcatgaatatttgtatgtgctgccctgtt
gttcaaggatacggactcacagaaacttgtggagctgcttgtgttgctgatatcaacgac
ttgagcacaggaaccgttggtcccccagtcagatgctcagatattgctcttcgtgagtgg
tccgaaggtggatactcaccattcaatgatccaccacaaggagagattcttatttctgga
gaaaacatctcacctggatattataaacaaccagaaaagaccgctgaagatttcatcacc
tataaaggaaaagtgtactttgccactggagatattggacagaagcgtgatgatggttct
cttctcattattgacagaaagaaggatttggttaaattgcaacacggagaatatgtttct
ctcgctaaagttgaatgtgcacttctcaattgcccaattgttgataacatctgcgtttat
ggaagtggaatggaagacagtgttgttgctcttgtggttccaaaccagaagcacttggag
aagattgctgaagcggaaggtgtatcaactagtgaaatgaagacgatgtgtgaagataag
aaggtcattgctgcctacaagaaacaactcgaagaacatgccaagaaaagcaaactttcc
cgctctgaaatcccagccgcgattcatctttgccccgagatttggactcctgacactggc
cttcttaccgaagcactcaagctgaagagaaagcctatccaaatggcctaccagaagacc
ctcgatgatctgtataagcagctcaaaaagaattga

DBGET integrated database retrieval system