KEGG   Caenorhabditis elegans (nematode): CELE_F38A6.3
Entry
CELE_F38A6.3      CDS       T00019                                 

Gene name
hif-1
Definition
(RefSeq) Hypoxia-inducible factor 1
  KO
K08268  hypoxia-inducible factor 1 alpha
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04137  Mitophagy - animal
cel04140  Autophagy - animal
cel04212  Longevity regulating pathway - worm
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CELE_F38A6.3 (hif-1)
   04137 Mitophagy - animal
    CELE_F38A6.3 (hif-1)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_F38A6.3 (hif-1)
  09149 Aging
   04212 Longevity regulating pathway - worm
    CELE_F38A6.3 (hif-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cel03000]
    CELE_F38A6.3 (hif-1)
Transcription factors [BR:cel03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    CELE_F38A6.3 (hif-1)
SSDB
Motif
Pfam: PAS_11 PAS_3 PAS PAS_9 PAS_4
Other DBs
NCBI-GeneID: 180359
NCBI-ProteinID: NP_001023891
WormBase: WBGene00001851
UniProt: G5EGD2
LinkDB
Position
V:join(20780502..20780521,20781315..20781505,20781632..20781786,20781832..20782146,20782664..20783222,20783738..20784065,20784136..20784392,20784473..20784645,20784694..20784861)
AA seq 721 aa
MEDNRKRNMERRRETSRHAARDRRSKESDIFDDLKMCVPIVEEGTVTHLDRIALLRVAAT
ICRLRKTAGNVLENNLDNEITNEVWTEDTIAECLDGFVMIVDSDSSILYVTESVAMYLGL
TQTDLTGRALRDFLHPSDYDEFDKQSKMLHKPRGEDTDTTGINMVLRMKTVISPRGRCLN
LKSALYKSVSFLVHSKVSTGGHVSFMQGITIPAGQGTTNANASAMTKYTESPMGAFTTRH
TCDMRITFVSDKFNYILKSELKTLMGTSFYELVHPADMMIVSKSMKELFAKGHIRTPYYR
LIAANDTLAWIQTEATTITHTTKGQKGQYVICVHYVLGIQGAEESLVVCTDSMPAGMQVD
IKKEVDDTRDYIGRQPEIVECVDFTPLIEPEDPFDTVIEPVVGGEEPVKQADMGARKNSY
DDVLQWLFRDQPSSPPPARYRSADRFRTTEPSNFGSALASPDFMDSSSRTSRPKTSYGRR
AQSQGSRTTGSSSTSASATLPHSANYSPLAEGISQCGLNSPPSCSIKSGQVVYGDARSMG
RSCDPSDSSRRFSALSPSDTLNVSSTRGINPVIGSNDVFSTMPFADSIAIAERIDSSPTL
TSGEPILCDDLQWEEPDLSCLAPFVDTYDMMQMDEGLPPELQALYDLPDFTPAVPQAPAA
RPVHIDRSPPAKRMHQSGPSDLDFMYTQHYQPFQQDETYWQGQQQQNEQQPSSYSPFPML
S
NT seq 2166 nt   +upstreamnt  +downstreamnt
atggaagacaatcggaaaagaaacatggaacgccgtcgtgaaacatcgagacacgcggct
cgtgatcgtcggtctaaagaatcggatatatttgatgatctgaaaatgtgtgtgcctatt
gttgaagaaggtaccgtaactcatctagaccgtattgcacttcttcgtgttgccgccaca
atttgtcgactgcgcaagacagccggtaatgtattggaaaacaatttggacaatgaaatc
acaaatgaggtatggactgaagacaccatcgccgaatgcttggacggctttgttatgatt
gttgacagtgattcttcaattctttacgtcactgaaagtgttgcaatgtatttaggatta
acacagacagatttaacaggtcgagcccttcgagactttcttcatccatccgactatgac
gagtttgacaagcaatcaaaaatgctgcacaagccacgtggcgaggacacagacaccacc
ggcatcaacatggtgcttcgaatgaagacagtcatcagcccacgtggaagatgtctgaat
ttgaagagtgctttgtacaaatcagtgtctttcctggttcattcaaaagtttcaactggt
ggacacgtgtcattcatgcaaggtatcacaattcctgctggacagggtacaactaatgca
aatgcatctgcaatgacaaagtacacggaaagcccaatgggtgcattcacaactcgtcac
acttgcgacatgcgcatcactttcgtttcggataagttcaattacatcttgaaaagtgag
ctgaagactctcatgggcaccagtttctacgaattggtacatccagccgatatgatgata
gtatcaaaatccatgaaggaactttttgccaaaggacacatccgtaccccgtattaccgg
ttgattgctgcaaatgacacacttgcctggattcaaacagaagctactacaatcacacat
acgacgaaaggacaaaaaggacaatatgtcatttgtgttcattacgttctcggaatccaa
ggagctgaagagtcattggtagtttgcactgattcaatgccagctggaatgcaagtagat
atcaagaaggaagtggatgatacaagagactatattggaagacaacctgaaattgtggaa
tgcgtcgattttactccattgatcgagccagaagatccatttgatacggttattgagcca
gtcgttggtggagaagaacctgttaagcaggctgatatgggagcacgtaagaacagctac
gatgacgttttgcaatggctttttcgcgaccagccaagctctccgccgccggcacgctac
cggtcagcggaccgcttcaggacaaccgaaccgtcgaatttcggttccgctctggcctcg
ccggacttcatggattcgtcatctcgtacctcccgaccgaagacatcatacggacgaaga
gcacaaagtcagggaagtcgaacaactggatcgtcttccacgtcagcatcggccacattg
ccacacagtgccaactactcgccacttgcagagggcatctcacaatgtggacttaacagt
cccccgagttgcagtatcaaatctggacaagtcgtgtacggagacgctcgatctatggga
cgtagctgcgatccgtccgattcgtcacgacgcttttccgccctttcaccatcagatact
ctcaatgtgtcgtccactagaggcatcaacccagtcatcggaagcaatgatgtgttctcc
actatgccttttgccgattctatcgccattgccgaaaggatcgattcgtcgccaacatta
acctctggcgaaccaatactttgtgacgatcttcaatgggaagagcctgatttatcgtgc
ttggcaccattcgttgacacttatgatatgatgcaaatggacgaggggttaccaccagag
cttcaagctctttacgacttgcctgactttacacctgcggtacctcaagccccagctgct
cggcctgtgcacattgacagaagcccaccagcgaagcgaatgcaccaatcaggtccctca
gatttagattttatgtacactcaacattatcaaccattccaacaagacgagacatattgg
caaggacagcaacagcaaaatgaacaacagcctagttcttattccccatttccaatgctc
tcttga

DBGET integrated database retrieval system