KEGG   Caenorhabditis elegans (nematode): CELE_F40E10.4
Entry
CELE_F40E10.4     CDS       T00019                                 

Gene name
slt-1
Definition
(RefSeq) Slit homolog 1 protein
  KO
K06839  slit 2
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_F40E10.4 (slt-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cel00536]
    CELE_F40E10.4 (slt-1)
Glycosaminoglycan binding proteins [BR:cel00536]
 Heparan sulfate / Haparin
  Axon guidance molecules
   CELE_F40E10.4 (slt-1)
SSDB
Motif
Pfam: LRR_8 LRR_4 EGF LRR_5 Laminin_G_2 Laminin_G_1 LRRNT LRR_1 LRR_9 hEGF EGF_CA LRRCT EGF_3 EGF_2
Other DBs
NCBI-GeneID: 181562
NCBI-ProteinID: NP_510437
WormBase: WBGene00004854
Ensembl: WBGene00004854
UniProt: G5EFX6
LinkDB
Position
X:join(14674375..14674520,14674564..14674635,14675083..14675154,14675198..14675269,14675322..14675420,14675470..14675577,14675646..14675790,14675846..14676006,14676478..14676549,14676602..14676673,14676724..14677103,14677669..14677765,14677815..14678015,14678062..14678133,14678189..14678260,14678309..14678457,14678507..14678714,14678759..14678855,14679465..14679583,14679635..14679790,14679841..14680165,14680211..14680344,14680882..14680975,14681023..14681148,14681193..14681371,14681418..14681542,14681593..14681811,14682366..14682473,14682523..14682624,14682674..14682786,14682845..14682909,14682955..14683027)
AA seq 1410 aa
MLICFIFILLIPESATCPAECVCVDRTVSCVGQQLTEVPQNIPNDTIRLDLQDNEITKIG
PNDFSSLMNLKALQLMDNQIVTIHNQSFSSLVFLQKLRLSRNRIRHLPDNVFQNNLKLTH
LDLSENDITVVSDAQLQGPEFLEVLNLDKNHIFCLENNVISSWVSLEVLTLNGNRLTTFE
EPSNARFRQLDLFNNPWNCDCRLRWMRKWLEKAEGQNKTVCATPLNLQGSSIEILQDKFM
TCSGNRKRRYKKTCETAEICPLPCTCTGTTVDCRDSGLTYVPTNLPPSTTEIRLEQNQIS
SIPSHSFKNLKNLTRLDLSKNIITEIQPKAFLGLHNLHTLVLYGNNITDLKSDTFEGLGS
LQLLLLNANQLTCIRRGTFDHVPKLSMLSLYDNDIKSISEVTFQNLTSLSTLHLAKNPLI
CDCNLQWLAQINLQKNIETSGARCEQPKRLRKKKFATLPPNKFKCKGSESFVSMYADSCF
IDSICPTQCDCYGTTVDCNKRGLNTIPTSIPRFATQLLLSGNNISTVDLNSNIHVLENLE
VLDLSNNHITFINDKSFEKLSKLRELRLNDNKLHHFSSMVLDEQSNLEILDLSGNNIQCF
SSIFFNKATRIREIKVIGNDLLCDCRILPLMSWLRSNSSHSIDIPPCQQFQYSDNESDKQ
RCAAFPEETCSDDSNLCPPKCSCLDRVVRCSNKNLTSFPSRIPFDTTELYLDANYINEIP
AHDLNRLYSLTKLDLSHNRLISLENNTFSNLTRLSTLIISYNKLRCLQPLAFNGLNALRI
LSLHGNDISFLPQSAFSNLTSITHIAVGSNSLYCDCNMAWFSKWIKSKFIEAGIARCEYP
NTVSNQLLLTAQPYQFTCDSKVPTKLATKCDLCLNSPCKNNAICETTSSRKYTCNCTPGF
YGVHCENQIDACYGSPCLNNATCKVAQAGRFNCYCNKGFEGDYCEKNIDDCVNSKCENGG
KCVDLINSYRCDCPMEYEGKHCEDKLEYCTKKLNPCENNGKCIPINGSYSCMCSPGFTGN
NCETNIDDCKNVECQNGGSCVDGILSYDCLCRPGYAGQYCEIPPMMDMEYQKTDACQQSA
CGQGECVASQNSSDFTCKCHEGFSGPSCDRQMSVGFKNPGAYLALDPLASDGTITMTLRT
TSKIGILLYYGDDHFVSAELYDGRVKLVYYIGNFPASHMYSSVKVNDGLPHRISIRTSER
KCFLQIDKNPVQIVENSGKSDQLITKGKEMLYIGGLPIEKSQDAKRRFHVKNSESLKGCI
SSITINEVPINLQQALENVNTEQSCSATVNFCAGIDCGNGKCTNNALSPKGYMCQCDSHF
SGEHCDEKRIKCDKQKFRRHHIENECRSVDRIKIAECNGYCGGEQNCCTAVKKKQRKVKM
ICKNGTTKISTVHIIRQCQCEPTKSVLSEK
NT seq 4233 nt   +upstreamnt  +downstreamnt
atgctgatttgcttcatatttattctacttatacctgaaagtgccacgtgtccggcagaa
tgcgtgtgcgtggaccgaactgtgtcgtgtgttggccaacaactcacagaagttccacaa
aatatcccgaatgatacaattagattagatctacaagacaatgaaataaccaaaatcgga
ccgaacgatttcagcagtcttatgaatttaaaagctttacaacttatggacaatcaaatt
gtcactattcacaatcaaagttttagttctctggtatttcttcaaaagctgcgattaagc
agaaatcgtatacgccatttaccagataacgtgtttcagaacaatctgaaacttactcac
ttagacttgagtgaaaatgacataacagtggtttctgacgcacaactacaaggtcctgaa
tttttggaagtcttgaacttggataaaaatcatatcttctgtcttgagaacaatgtgatt
tcttcttgggtgtctctagaagtacttacactgaatggaaaccgattaacaacatttgaa
gagccctcaaatgcaagattccgacaattggaccttttcaataatccttggaattgcgat
tgccgtttgagatggatgcgaaaatggctagaaaaagcagaggggcagaataaaacagtt
tgtgcaactccactcaacttgcaagggtcctcgatagaaattctccaagacaagtttatg
acgtgttccggaaaccgaaaacgtagatataagaaaacctgcgaaactgcggaaatttgt
ccactaccatgcacgtgcactggaacgactgtagattgtcgggattccgggttgacatac
gtaccaacaaaccttccaccgtctaccacagaaataagactcgaacaaaatcagatttca
tcaattccctctcactccttcaaaaatctgaagaacttgacacgactagatctgagcaaa
aatataatcactgaaatccaaccgaaagcgtttctcggtcttcacaatctgcacacatta
gtgctctacgggaataatataaccgacttgaaatcggatactttcgagggacttggaagt
ttacaattattactcctcaatgccaatcaattgacgtgcattcggaggggaacatttgac
catgtcccgaagttgagcatgttgtcattatatgataacgatatcaagtcaatcagtgaa
gtaacatttcaaaatcttaccagcttgagtacactgcatcttgccaagaatccactgatt
tgtgattgcaatttgcaatggctggcgcaaataaatttacagaagaatattgaaacaagt
ggagcaagatgtgaacaacccaaacggctgagaaaaaagaaatttgcaactttaccgcca
aataagttcaaatgcaaaggttccgagtcatttgtcagcatgtacgccgactcttgtttt
atcgactcaatttgtccgactcaatgtgattgctatggtacaactgttgattgcaacaag
cgtggacttaacactattccaacttcaattccccgctttgcaacacaactcctcttatct
ggaaacaatatctctaccgtcgatctcaattctaacatccatgtcctagaaaacctggaa
gttctagatttgtcaaacaatcacatcacattcatcaacgacaagagtttcgaaaaactt
tctaagttgagagaactaagactaaatgacaataaactacaccatttttcaagtatggtt
ttggatgagcaatcaaatttggaaatattagacttatcaggaaataacattcaatgcttc
tcttctatatttttcaacaaagctacccgtattagagaaattaaagtaatcggtaacgac
ttgctttgtgattgccgaatccttccgttaatgtcttggcttcgatcaaactctagtcat
tcaatcgacattccaccatgccagcaatttcaatacagcgataatgagtcagataagcaa
cggtgtgcagcattccccgaagagacatgctctgatgacagtaacctttgcccaccaaaa
tgctcctgtttggatcgtgtcgtccggtgctcaaacaaaaatctcaccagtttcccgagt
agaataccattcgacactacagagctttatcttgatgccaattatatcaatgaaatccca
gctcatgatctgaaccggttgtattctcttactaagctagatctttcacacaatcgactc
atatctctggaaaataatacgttctccaatttgactcggttatcaactttgatcataagc
tacaacaaactgaggtgcttgcaacctcttgctttcaatggattgaacgctcttcgcatt
ctttcccttcatggtaacgatatctcattcctgccgcaatccgcattctcaaatctgact
agtatcactcacatagccgttggtagcaattcgctttattgcgactgcaatatggcatgg
ttctcaaaatggatcaaatctaaatttattgaagctggaattgcaagatgtgaataccca
aatacggtttctaatcaacttctgctaactgcacaaccctatcagtttacatgcgattca
aaagttccaacaaaacttgcaacaaaatgcgatctttgtctcaattctccatgcaaaaac
aatgccatctgtgaaacaacgagcagcagaaaatacacatgcaattgtactcctggattc
tatggtgttcattgcgaaaaccaaatcgatgcttgttacggctcaccatgcttaaacaat
gcaacatgcaaagttgcacaagctggtcgcttcaactgttattgtaacaaaggattcgaa
ggagattattgcgagaaaaatattgacgactgtgtgaactccaagtgtgaaaatggaggg
aaatgtgtagatttgataaattcttatcgttgtgactgcccaatggagtacgaagggaaa
cactgcgaggataaactggagtactgcactaaaaagttgaatccatgcgagaataatgga
aagtgtattccaattaatggctcttacagttgtatgtgctctcctggtttcactggtaat
aactgtgaaactaacattgacgactgcaagaatgtggaatgtcaaaatggtggaagttgt
gtggatggaattctttcttacgattgtttgtgcagacctggatacgctggacagtactgt
gagatcccgccaatgatggatatggagtatcaaaaaaccgatgcttgccaacaatctgca
tgtggacagggagaatgcgttgctagccaaaactcttctgatttcacatgcaaatgtcat
gaaggattcagcggtccaagttgtgatagacagatgtctgtcgggttcaagaatccagga
gcgtatcttgcgttagacccattagcaagtgatgggacaattacaatgactttgagaact
acttcaaaaataggaatacttttgtactatggagatgaccattttgtatctgctgagtta
tatgatggaagggtaaagttggtttattatattggtaactttccagctagccatatgtac
agttcggtgaaagtgaatgacgggctaccgcataggatctccattcgaacctcggaacga
aagtgttttttgcaaattgataaaaacccagttcaaattgtggagaacagtgggaaatct
gaccagctaatcacaaaaggcaaagaaatgctgtatatcggaggactgccaatcgaaaaa
tctcaagatgcaaagagaaggttccacgtgaagaattcagagagtttgaaaggttgtatc
agttcaatcacgataaatgaagtgccgatcaatttgcaacaagctctagagaacgtcaac
acagagcaaagctgctctgcgaccgtaaacttttgtgcaggcatcgattgtggaaacgga
aagtgcacgaataatgccctatcaccaaaaggctacatgtgccaatgcgattctcatttt
tcaggagagcattgtgatgaaaaaagaatcaaatgtgacaagcaaaagttcagaaggcat
catatagaaaatgagtgtagatcggttgacagaatcaagatagcagagtgtaatggttac
tgtggaggcgaacagaattgttgcactgctgtgaagaaaaagcagagaaaagtgaaaatg
atatgcaaaaatggaacaacaaaaatctccactgttcacattattcgtcagtgccaatgt
gaacctacaaaaagtgttctctctgaaaagtga

DBGET integrated database retrieval system