KEGG   Caenorhabditis elegans (nematode): CELE_F41C6.1
Entry
CELE_F41C6.1      CDS       T00019                                 

Gene name
unc-6
Definition
(RefSeq) Netrin unc-6
  KO
K06843  netrin 1
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_F41C6.1 (unc-6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cel00536]
    CELE_F41C6.1 (unc-6)
Glycosaminoglycan binding proteins [BR:cel00536]
 Heparan sulfate / Haparin
  Axon guidance molecules
   CELE_F41C6.1 (unc-6)
SSDB
Motif
Pfam: Laminin_N NTR Laminin_EGF BNR_6
Other DBs
NCBI-GeneID: 180961
NCBI-ProteinID: NP_509165
WormBase: WBGene00006746
Ensembl: WBGene00006746
UniProt: P34710
LinkDB
Position
X:join(6889740..6889817,6889865..6890004,6890458..6890998,6891049..6891210,6891293..6891407,6892516..6892585,6892636..6892754,6894825..6894974,6895180..6895230,6895337..6895405,6895459..6895647,6895926..6896014,6896563..6896628)
AA seq 612 aa
MITSVLRYVLALYFCMGIAHGAYFSQFSMRAPDHDPCHDHTGRPVRCVPEFINAAFGKPV
IASDTCGTNRPDKYCTVKEGPDGIIREQCDTCDARNHFQSHPASLLTDLNSIGNMTCWVS
TPSLSPQNVSLTLSLGKKFELTYVSMHFCSRLPDSMALYKSADFGKTWTPFQFYSSECRR
IFGRDPDVSITKSNEQEAVCTASHIMGPGGNRVAFPFLENRPSAQNFENSPVLQDWVTAT
DIKVVFSRLSPDQAELYGLSNDVNSYGNETDDEVKQRYFYSMGELAVGGRCKCNGHASRC
IFDKMGRYTCDCKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDA
ELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSLGK
SCNQSSGQCVCKPGVTGTTCNRCAKGYQQSRSTVTPCIKIPTKADFIGSSHSEEQDQCSK
CRIVPKRLNQKKFCKRDHAVQMVVVSREMVDGWAKYKIVVESVFKRGTENMQRGETSLWI
SPQGVICKCPKLRVGRRYLLLGKNDSDHERDGLMVNPQTVLVEWEDDIMDKVLRFSKKDK
LGQCPEITSHRY
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgatcacatcagtattgcgctatgtgctagcgctctacttttgtatgggcatagctcat
ggagcatacttttcacagttctccatgagagccccagaccatgatccttgccatgatcat
actggtcgaccagttcgatgtgttcccgagttcataaatgctgcttttggaaaacctgtt
attgctagtgatacatgcggaacaaaccgaccagacaaatattgtactgtgaaggagggt
ccggatggaattatccgtgagcaatgtgacacttgtgatgctagaaaccatttccaatcc
catccagcctctcttctaactgatctcaattcgattggaaacatgacatgctgggtttcc
actccaagtttgagcccacaaaacgtttcactcactttgtcactcggaaaaaagtttgag
ctcacttacgtctcaatgcacttctgttcccgtctcccagattcaatggcactttacaag
tctgctgactttggaaagacctggaccccgtttcaattctactcctccgaatgtcgtcgt
atatttggcagagatcccgacgtgtcgataacaaagtcaaacgagcaagaagccgtttgt
actgcctctcatataatgggtccaggaggaaaccgtgtagcgttcccttttctagagaac
agaccttctgcacaaaacttcgaaaactcgccggtgcttcaggattgggtcaccgcaact
gacattaaagtggtgttttcaaggcttagtccagatcaggctgaactgtatggcttgtct
aacgatgtcaattcgtacggaaacgagacggatgatgaagtcaaacaacgttacttctac
tcaatgggagaactggcagttggtggtcgctgcaaatgtaatggtcacgccagtagatgc
atctttgacaaaatgggccggtacacttgtgactgcaagcataacactgccggaactgaa
tgcgaaatgtgcaaaccattccattacgatcgtccatggggaagagccaccgcaaattct
gccaactcatgtgtcgcttgcaactgcaaccaacacgcaaagagatgccgattcgatgct
gagctctttagactaagtggcaaccgatcaggaggagtgtgcttgaactgtcgtcataac
actgctggaagaaattgtcatctctgcaaaccaggatttgtccgtgatacttctctgcca
atgacacatcggaaagcttgtaaatcttgtggatgtcatccagtcggatcacttggaaaa
agctgcaaccaatcatcgggtcagtgcgtctgcaagcctggagtcactggaacaacctgt
aatcgttgtgccaaaggataccaacaaagccgttctacagttactccgtgtatcaaaatt
ccgaccaaagctgatttcattggatcatcacattcagaagagcaagatcagtgttcgaag
tgcagaattgttccgaagagactcaaccagaagaagttctgcaagcgggatcatgctgtc
cagatggttgtggtcagccgtgagatggttgatggatgggccaagtacaagattgtggtt
gaatcagttttcaaacgaggcaccgagaacatgcaacgtggcgaaacatcattgtggatt
tcccctcaaggtgtcatttgcaagtgcccaaagctccgcgtcggacgccgttatctcctc
cttggcaagaatgattccgatcacgagcgcgatggattgatggtcaatccacagactgta
ttggtggaatgggaggacgatattatggataaggtactacgcttctcgaaaaaagataaa
cttggacaatgcccagagattacgtcacacagatactga

DBGET integrated database retrieval system