KEGG   Caenorhabditis elegans (nematode): CELE_F57F5.1Help
Entry
CELE_F57F5.1      CDS       T00019                                 

Gene name
F57F5.1
Definition
(RefSeq) Uncharacterized protein
  KO
K01363  cathepsin B [EC:3.4.22.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04140  Autophagy - animal
cel04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    CELE_F57F5.1 (F57F5.1)
   04140 Autophagy - animal
    CELE_F57F5.1 (F57F5.1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cel01002]
    CELE_F57F5.1 (F57F5.1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cel03110]
    CELE_F57F5.1 (F57F5.1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_F57F5.1 (F57F5.1)
   00536 Glycosaminoglycan binding proteins [BR:cel00536]
    CELE_F57F5.1 (F57F5.1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.1  cathepsin B
     CELE_F57F5.1 (F57F5.1)
Peptidases and inhibitors [BR:cel01002]
 Cysteine peptidases
  Family C1: papain family
   CELE_F57F5.1 (F57F5.1)
Chaperones and folding catalysts [BR:cel03110]
 Intramolecular chaperones
  Papain family
   CELE_F57F5.1 (F57F5.1)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   CELE_F57F5.1 (F57F5.1)
Glycosaminoglycan binding proteins [BR:cel00536]
 Heparan sulfate / Haparin
  Others
   CELE_F57F5.1 (F57F5.1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C1 Peptidase_C1_2 Propeptide_C1
Motif
Other DBs
NCBI-GeneID: 179645
NCBI-ProteinID: NP_506011
WormBase: WBGene00010204
Ensembl: WBGene00010204
UniProt: Q20950
LinkDB All DBs
Position
V:join(12003174..12003176,12003233..12003478,12003575..12004381)
Genome map
AA seq 351 aa AA seqDB search
MKTAIAALLVGLVAVNAYNVEVKHGDAIPVEAQMLRGQELVDYVNKVQTSFKAELGSYFS
SYPDTIKKQLMGAKMVEIPEEYRVFEMTHPEVEDAAVPDSFDSRTAWPNCPSISKIRDQS
SCGSCWAVSAAETISDRICIASNAKTILSISADDINACCGMVCGNGCNGGYPIEAWRHYV
KKGYVTGGSYQDKTGCKPYPYPPCEHHVNGTHYKPCPSNMYPTDKCERSCQAGYALTYQQ
DLHFGQSAYAVSKKAAEIQKEIMTHGPVEVAFTVYEDFEHYSGGVYVHTAGASLGGHAVK
MLGWGVDNGTPYWLCANSWNEDWGENGYFRIIRGVNECGIEGGVVGGIPKL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgcaattgctgctcttcttgtcggccttgtcgccgtcaacgcctacaatgtt
gaggttaagcacggagatgccattccagttgaagctcaaatgcttcgtggacaggaactt
gttgattacgtcaacaaggttcagacttccttcaaggctgagctcggatcatacttcagc
tcttacccagataccattaagaagcaattgatgggagctaagatggtcgagatcccagaa
gagtacagagttttcgagatgactcatccagaagtcgaggatgctgctgttccagactca
ttcgattcccgtaccgcatggccaaactgcccatccatctccaagatccgtgatcaatca
tcctgtggatcgtgctgggctgtctctgctgctgaaactatttctgatcgtatttgcatt
gcgtcaaatgccaaaactatcctttccatctctgctgacgatatcaatgcttgctgtgga
atggtctgtggaaatggatgcaatggtggatatccaattgaagcctggcgtcactatgtt
aagaagggatacgttaccggaggatcttatcaagataagactggatgcaagccataccca
tatccaccatgtgaacatcacgtcaatggaactcattacaagccatgcccatccaacatg
tacccaactgacaaatgcgaacgctcttgccaagctggatatgctctcacctaccaacaa
gatcttcacttcggacaatctgcatacgccgtctcaaagaaggctgctgaaatccaaaag
gaaatcatgactcatggtccagttgaggttgcattcactgtctacgaagattttgagcat
tactccggaggagtctacgttcataccgctggagccagtcttggaggacatgccgtaaag
atgctcggatggggagttgataatggaacaccatattggctctgtgccaactcatggaat
gaggattggggagagaacggatatttccgtatcattcgtggagttaacgagtgcggaatt
gagggaggagtcgtcggaggaattccaaaattgtaa

DBGET integrated database retrieval system