KEGG   Caenorhabditis elegans (nematode): CELE_JC8.4
Entry
CELE_JC8.4        CDS       T00019                                 

Symbol
JC8.4
Name
(RefSeq) CMP/dCMP-type deaminase domain-containing protein
  KO
K15441  tRNA-specific adenosine deaminase 2 [EC:3.5.4.-]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cel03016]
    CELE_JC8.4 (JC8.4)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.-  
     CELE_JC8.4 (JC8.4)
Transfer RNA biogenesis [BR:cel03016]
 Eukaryotic type
  tRNA modification factors
   Deaminases
    CELE_JC8.4 (JC8.4)
SSDB
Motif
Pfam: dCMP_cyt_deam_1 MafB19-deam APOBEC_N SNAD4 NAD1 Bd3614-deam APOBEC2
Other DBs
NCBI-GeneID: 178281
NCBI-ProteinID: NP_502546
WormBase: WBGene00010436
Ensembl: WBGene00010436
UniProt: Q95QD6
LinkDB
Position
IV:13243675..13244205
AA seq 176 aa
MSENELSAEDTAFLEKAFELAQEALDEDEVPVGCVFVVNGTEIGRGRNRVNETGDPTRHA
EMVAVTEMWKEHGTGCEDLLKKSTLYVSLEPCIMCSSAMYQLGIRKMVYGAENPRFGGVR
SVGSAEKYRMEDNVQIVAGIWSERSVAMLKTFYEKLNPFAPPEKRKTKKPKLDEIK
NT seq 531 nt   +upstreamnt  +downstreamnt
atgtcagaaaacgagctgagcgccgaggacactgcatttctggaaaaagccttcgaattg
gctcaagaagctttagatgaagatgaagttccagttggatgtgtatttgtggtcaatgga
acagaaattggaagaggtcggaatcgtgtgaacgagaccggtgatccgacaaggcatgct
gagatggtagcagtcactgaaatgtggaaagagcacggaacgggctgcgaggatctgctc
aaaaaatccacgctctacgtttccctggagccctgcataatgtgctcgtcggcaatgtat
cagctgggaattcgaaaaatggtgtatggagccgaaaatccacgattcggaggtgtacgg
agtgttggaagtgcggagaagtaccgaatggaggataatgtgcaaattgtggctggaatt
tggtcggaacgatctgtcgccatgctgaaaacattctacgagaagcttaacccatttgca
ccgcctgaaaagcggaaaactaaaaaaccaaagttagatgaaattaaatga

DBGET integrated database retrieval system