KEGG   Caenorhabditis elegans (nematode): CELE_K01G5.7Help
Entry
CELE_K01G5.7      CDS       T00019                                 

Gene name
tbb-1
Definition
(RefSeq) Tubulin beta chain
  KO
K07375  tubulin beta
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04145  Phagosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    CELE_K01G5.7 (tbb-1)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     CELE_K01G5.7 (tbb-1)
Cytoskeleton proteins [BR:cel04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    CELE_K01G5.7 (tbb-1)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_K01G5.7 (tbb-1)
  Exosomal proteins of colorectal cancer cells
   CELE_K01G5.7 (tbb-1)
  Exosomal proteins of bladder cancer cells
   CELE_K01G5.7 (tbb-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Motif
Other DBs
NCBI-GeneID: 176501
NCBI-ProteinID: NP_499367
WormBase: WBGene00006536
Ensembl: WBGene00006536
UniProt: O17921
LinkDB All DBs
Position
III:complement(join(10740981..10741358,10741409..10742214,10742260..10742425))
Genome map
AA seq 449 aa AA seqDB search
MREIVHVQAGQCGNQIGSKFWEVISDEHGIQPDGTFKGESDLQLERIDVYYNEANNGKYV
PRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDNVLDVI
RKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMSSFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICYRTLKLTNPTYGDLNHLVSLTMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLSAKGAQAYRALTVAELTQQMFDAKNMM
AACDPRHGRYLTVAAMFRGRMSMREVDEQMLSVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMAATFVGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLIS
EYQQYQEATAEDEPLDEFAGEGETYESEQ
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaatcgtccacgttcaagccggacagtgcggaaaccagatcgggtccaagttc
tgggaagtcatctccgatgagcacggaatccagcccgacggaaccttcaagggagaaagc
gatctccagctggagagaatcgatgtctactacaacgaggccaacaatggcaaatacgtt
ccacgtgcagtcctcgttgatctcgagccaggaacgatggattctgtgcggtccggtcct
ttcggacaactcttcagaccagacaactttgttttcggacaatctggagctggaaacaat
tgggccaagggacattacaccgagggagcagaacttgttgacaacgtgctcgatgtgatc
cgcaaagaggctgaaggatgcgattgtcttcaaggattccagctcacacactctcttgga
ggtggaaccggatccggaatgggaacccttctcatctccaagattcgcgaggaattccca
gatcgaattatgtcttccttctcggttgttccatcaccaaaggtttcggataccgtcgtc
gagccgtacaatgccaccctctctgtccaccagcttgttgagaacaccgacgagacttac
tgtatcgataacgaggctctctacgatatctgctacagaactctaaagctcaccaaccca
acatacggagacctgaaccatctcgtgtctctcacaatgtctggagtgactacctgcctc
cgcttccctggacagctgaacgctgatcttcgcaagttggctgtcaacatggttccattc
ccacgtcttcatttcttcatgcctggattcgctccactctccgccaagggagctcaggct
taccgtgcattgactgtcgccgagcttactcaacaaatgttcgacgccaagaacatgatg
gctgcttgcgatccaagacacggaagatacctcaccgttgctgctatgttccgtggacgc
atgtccatgagagaggttgacgagcagatgctcagtgtccagaacaagaactcctcgtac
ttcgttgaatggattccaaacaacgtcaagactgctgtgtgcgacatcccaccacgtgga
ctcaagatggctgccaccttcgtcggaaactccactgctatccaggagctcttcaagcgt
atctcggagcaattcaccgccatgttccgcagaaaggccttccttcattggtacactggt
gagggtatggacgagatggagttcaccgaggctgaaagcaacatgaacgacttgatctcg
gagtaccaacaataccaggaagctaccgccgaagacgagccactcgacgagttcgccgga
gaaggggagacatacgagtctgagcaataa

DBGET integrated database retrieval system