KEGG   Caenorhabditis elegans (nematode): CELE_K11D9.1
Entry
CELE_K11D9.1      CDS       T00019                                 

Gene name
klp-7
Definition
(RefSeq) Kinesin-like protein
  KO
K10393  kinesin family member 2/24
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_K11D9.1 (klp-7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_K11D9.1 (klp-7)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cel04812]
    CELE_K11D9.1 (klp-7)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     CELE_K11D9.1 (klp-7)
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    CELE_K11D9.1 (klp-7)
Cytoskeleton proteins [BR:cel04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     CELE_K11D9.1 (klp-7)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 176511
NCBI-ProteinID: NP_001022677
WormBase: WBGene00002219
Ensembl: WBGene00002219
UniProt: Q9XU12
LinkDB
Position
III:join(10805930..10806098,10808341..10808459,10808600..10808816,10808865..10809522,10809573..10810034,10810085..10810396,10810444..10810750)
AA seq 747 aa
MKSCRSCKENPEVQRKRAEKPWRRAPKAKSEVEKHGIGPPDSDSGEEISFPWYNVTGKML
VVGMHVEIKRSDGRIHGAVIAEVKSNGRFMVEWYEKGETKGKESSLEELLTLNPSLQAPK
PTPPPQPPQKTLQASTAVNRQNGIHAQSMILDDEDTFLLDHINMIPAKGASANKRPTGAF
TQHVPVRMAPPSEKPLPTRRAPSPKEDAAPAPKSTRTTAAFKPDLDSTAITVPKHTARRT
VVVAPAPAPVPAPPIANMTSQRAPSPVARVPSPKNVPRSYPQQDVQPSNGNFAFAEMIRN
YRAQIDYRPLSMFDGVNENRISVCVRKRPLNKKELTKAEVDVITIPSRDITILHQPQTRV
DLTKYLDNQKFRFDYSFDEYANNELVYRFTAAPLVKTVFDNGTATCFAYGQTGSGKTHTM
GGDFSGKKQNASMGIYALTARDVFRMLEQPQYRRKDLSVHCAFFEIYGTKTYDLLNDKAE
LRVLEDKMQKVQVVGLKEEQAHNEQDVLELINKGTLVRTAGTTSANANSSRSHAIFQIIL
RQGKKVWGKFSLIDLAGNERGQDTRECDRDTRKEGANINTSLLALKECIRGMARNSSHVP
FRQSKLTMVLRDSFIGEKSRTVMISMISPGISSSDHTLNTLRYADRVKEMGTDGSGEATP
IRDEELFLPPSADKSDEEYDEMVEKQEHRRVAVDHVRNLKDMSEKIIRETTIVLSNEPSA
AQKAECLAKLDQLAQIVSNTRVAVENV
NT seq 2244 nt   +upstreamnt  +downstreamnt
atgaaaagttgcagaagttgtaaggaaaatcctgaagtgcagagaaaacgagccgagaag
ccgtggcgacgggctccgaaggccaaatcagaagtcgaaaagcatggaatcggtccaccg
gacagtgattcaggggaggaaatatcatttccttggtataatgtgaccggtaaaatgctt
gtcgtcgggatgcatgtggaaatcaagcggagcgacggccgcatccacggtgccgtaatc
gccgaagttaagtcgaacggccggtttatggtggaatggtatgagaagggcgagacaaaa
ggaaaggaatcctcgttggaagaacttctcacgctgaacccatcactccaagcaccgaag
cctacgccgccgccacagcctcctcaaaaaacgcttcaagcgtcaactgctgtcaacaga
caaaacgggatccatgcgcagagcatgatactcgatgacgaggatacattcctcttggat
catatcaacatgattccggctaaaggtgcttctgccaacaaacgaccaacgggagctttc
acgcagcacgttcctgttcgtatggctcctccatccgaaaagcctctcccgactcgtcgt
gctccgtcaccgaaggaggatgctgctcctgcaccgaagtctactcgtacgacagcagcc
ttcaagccagatcttgatagtacggcgatcacggttccgaagcacactgcaaggcgcaca
gttgtggtagctccagctccggcccctgttcctgctccaccaatcgccaacatgacatca
cagcgagccccgtctccagtggcaagagttccgtcgccgaagaacgtaccgcggtcgtat
ccacaacaggatgttcagccgtcgaatgggaactttgctttcgcggagatgattcgcaac
tacagagcccagatcgactatcgtccgttgagcatgttcgacggtgtcaacgagaatcgg
atttccgtttgcgttcggaagcgcccactgaacaagaaggagctgacgaaagcggaggtc
gatgtgatcacgatcccttctcgtgacatcacaattctccatcaaccacaaacacgtgtc
gacttgacaaagtatctggacaatcagaagttccgattcgattactctttcgacgagtac
gccaacaacgagctggtctatcgcttcactgcagcaccactcgtgaaaaccgtcttcgac
aatggaactgcgacgtgctttgcctacggtcaaacaggatccggaaagacgcacacaatg
ggtggagatttctccggaaagaagcagaatgcgtcgatgggaatctacgcgttgacggca
cgagatgtgttccggatgctcgagcagccacagtaccgtcgcaaggatctctcggtgcac
tgtgcgttcttcgagatttacggaacgaagacgtacgacttgctcaacgataaggccgag
cttcgtgtgcttgaggataagatgcagaaggtgcaggttgttgggctcaaagaggagcaa
gcgcacaatgagcaggatgtcttggagctcatcaacaaaggaactctggtcagaaccgct
ggaaccacttcggcaaacgcgaactcgtcgcgttctcacgccatattccagatcattctt
agacaaggcaaaaaggtgtggggcaagttctcgttgatcgacttggctggaaacgagcga
ggacaagacacgagagaatgcgatcgtgacacgcggaaagagggcgccaacatcaacaca
tcgctgctcgcactgaaggagtgcatccgtggaatggctcgcaacagctcacatgtcccg
ttcagacagtcgaagctcacgatggttctccgagacagcttcatcggtgagaagtccagg
acagtgatgatctcgatgatttcgccagggatctcgtcgagtgatcacacgctcaacaca
cttcgctacgcggatcgtgtcaaagaaatgggaaccgacggaagcggcgaagcaacccca
attcgagacgaggaattgttcctgcccccatcggcagacaaatcggatgaagagtacgat
gagatggtcgagaagcaagaacatcgtcgagtagcggtcgatcacgtccggaacctgaaa
gatatgtctgaaaagatcatacgcgaaacgacgattgtcctctccaacgagccgagtgct
gcccagaaagccgaatgcctcgccaagcttgatcaacttgcgcagatagtctcgaacacc
cgtgtcgccgtggaaaacgtctga

DBGET integrated database retrieval system