KEGG   Caenorhabditis elegans (nematode): CELE_M01D7.7
Entry
CELE_M01D7.7      CDS       T00019                                 

Gene name
egl-30
Definition
(RefSeq) Uncharacterized protein
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04020  Calcium signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    CELE_M01D7.7 (egl-30)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_M01D7.7 (egl-30)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_M01D7.7 (egl-30)
   04031 GTP-binding proteins [BR:cel04031]
    CELE_M01D7.7 (egl-30)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_M01D7.7 (egl-30)
GTP-binding proteins [BR:cel04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    CELE_M01D7.7 (egl-30)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29
Other DBs
NCBI-GeneID: 171751
NCBI-ProteinID: NP_740789
WormBase: WBGene00001196
Ensembl: WBGene00001196
UniProt: G5EGU1
LinkDB
Position
I:join(1835936..1836053,1838159..1838286,1838780..1838997,1839064..1839192,1839251..1839380,1840095..1840248,1840319..1840426,1840806..1840888)
AA seq 355 aa
MACCLSEEAREQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGQG
YSEEDKRAHIRLVYQNVFMAIQSMIRAMDTLDIKFGNESEELQEKAAVVREVDFESVTSF
EEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYLSDLRRLAVPDYLPTEQDILRVRV
PTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDN
ENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIA
AREFILKMFVDLNPDADKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggcctgctgtttatccgaagaggctcgcgagcagaagcgaataaatcaagaaattgag
aagcagcttcagcgtgacaaaagaaatgctcgacgagaactcaaacttcttttattgggg
actggagagtccggcaagtcaacgttcatcaagcagatgcgaattatccacggtcaggga
tattcggaagaggacaagcgagcacacattcgacttgtctatcagaacgtgtttatggcc
atacagtctatgatacgagcgatggacacattagatataaagtttggtaacgaatcagag
gagctgcaggagaaggcggctgtggtgcgggaagtggatttcgagtcggtgacgtctttc
gaggaaccctacgtgtcgtatatcaaagagctatgggaggattctggtattcaggaatgt
tatgataggaggcgagaatatcagctcaccgattcagccaaatactatctctccgatctc
cgacggctggcggtgccagactatctgccaaccgagcaggacattctgcgtgttcgtgtg
ccaaccactggtatcattgaatatccatttgatttggagcagatcatctttcgaatggtg
gacgtcggaggtcagcgatcagaaaggcggaagtggatccactgtttcgaaaatgtcacc
tcaatcatgttcctggtggcgctttccgagtatgatcaggtgttggtcgagtgtgacaac
gagaaccgaatggaagaatcgaaagctctgttccgaacgatcatcacgtacccatggttc
accaactcatcggtcattctattcctgaacaagaaggatctgctcgaggagaagattctg
tactcgcatctcgctgactactttcccgaatatgacggacccccacgcgatccgatcgcc
gcccgcgagtttattctcaaaatgtttgtcgacttgaatccggacgccgacaagattatc
tactctcattttacgtgcgcgactgatacggaaaacattcggttcgtgttcgccgccgtc
aaagacacaattctacagcataatctgaaggagtacaacttggtgtaa

DBGET integrated database retrieval system