KEGG   Caenorhabditis elegans (nematode): CELE_M03A1.1
Entry
CELE_M03A1.1      CDS       T00019                                 

Gene name
vab-1
Definition
(RefSeq) Ephrin receptor 1
  KO
K05110  Eph receptor B1 [EC:2.7.10.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_M03A1.1 (vab-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_M03A1.1 (vab-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     CELE_M03A1.1 (vab-1)
Protein kinases [BR:cel01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   CELE_M03A1.1 (vab-1)
Cytokine receptors [BR:cel04050]
 Receptor tyrosine kinase
  RTK class VIII (EPH receptor family)
   CELE_M03A1.1 (vab-1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ephrin_lbd EphA2_TM fn3 Pur_ac_phosph_N Ephrin_rec_like TMEM154 Kdo Kinase-like COX2_TM
Other DBs
NCBI-GeneID: 173794
NCBI-ProteinID: NP_494807
WormBase: WBGene00006868
UniProt: O61460
LinkDB
Position
II:join(4572089..4572182,4574122..4574201,4578121..4578263,4579049..4579349,4582473..4582722,4586259..4586408,4586463..4587248,4588139..4588237,4589009..4589634,4589688..4590512)
AA seq 1117 aa
MRLYNSRILNPHQSIFILVLQCLITIVTSHQEVLFDLSKVGSDLKWDQVSLRHDRDDVWM
EETWRNPAATDEKHANQRAYVTCNYDMINPSNWLFSHFIEVKTARRIYIELLFNTRDCDA
YLNPKSCKETFSVYLKQFKTSRPGSTKIEKERFSEDIDNWKNIGRLARSNSNMTTETLGM
EIDSDTKTIRIAFEEQGICLSLLNVKIYYRICDEFTDQLVYFRPQVTGPKETDMVRMNGS
CIPNASKKIPGVDLIGLCMSTGSGIKTSGECVCDSGYSQIADSNGARCESCPTNTYKPKG
QSLCKSCPSNSISSEAASSCRCLNGYFRAEDELISMPCTQPPSRPIKLVANAITATSTRL
SWNEPSSLGGRPEIWYEVKCSGRGECGTVVMTPGDKKLSTRSVQINGLRPSSDYTFLVFA
KNKVSAQFPEFSEKNAVIDIRTRSEEEDVPPVSHLRVDASQSDGITIAWSVSDSDVSDFE
VEVRPAIVKKRTFETRHVNMTYTTFIGLNPETVYQFRVRIRDDLRWSQPISYQLGRGLMS
SPSSNEVEESQFLNQTGSALLIIIALILIVIAVALCMIVVQKKSKNRKQMSDLDVLDTYK
QDSMTPDYHTTSRHHHHQGNLPATLHEQLRSTTKLNAPLIPSFGSPISQPPPYYGGVHPN
SGKYKTYVDPTTYEDPYQALIEFTFDISPNDVFITQVIGGGEFGDVCLGGLSKNSPAAAK
WSVSNTTMGRGGGGGGYESEPYETVAIKTLKSGSSAKAKAEFLTEATIMGQFSHPNVIRL
IGVVTSAEPVMIVAEYMANGSLDQFLRNTDQRGEKVHWEKITEMLYGIASGMKYLTDMGY
VHRDLAARNVLLDMELRCKIADFGLSRGVRSEGSSVEPEYTTNGGKIPVRWTAPEAITHR
KFTPSSDVWSFGVVIWEVCSFGERPYWDWTNQKVISEVMIGYRLPPPMDCPMGLYRIAQW
CWKMERHERPTFTQLLATFHKYILQPTLIEHDPGELPRRVQSQSALNTYGSVNVGVVPTP
PSSAAPMPSLDDFLRQIGLNHVYGQLVSNNIHSVSDLANTSHLDLLAYGLMSAECSTVRD
GLNGRISGSPPGSSGTIHATTRGTRTTRPPREEGFFV
NT seq 3354 nt   +upstreamnt  +downstreamnt
atgcggttgtacaattcgcggattctaaatccccaccaatcgatatttattctggttcta
cagtgtctgatcacaatcgtcacatcacatcaagaagttctcttcgacttgtccaaagtt
ggatcggatctaaaatgggaccaagtctcgctgcgacacgatcgagacgatgtgtggatg
gaagaaacttggcgaaatccagcggcgacagacgagaagcacgccaatcagagagcctac
gtcacgtgtaattatgatatgataaatccgagcaattggttgttcagtcattttatcgag
gttaaaactgcgaggagaatctacatcgaactgctcttcaacacacgtgactgtgatgcc
tacttgaatcccaaatcctgtaaagaaacattctccgtgtacctgaaacaattcaaaacg
tctcgacccggatctacaaaaatcgagaaggaacgattttcggaggatatcgataattgg
aagaatattggacggttggctcgaagtaattcaaatatgacgactgaaactcttggaatg
gaaatcgactcggacacgaaaacgattagaattgcattcgaagagcaaggaatttgtctt
tcacttttaaatgtcaagatttactaccgaatatgcgacgaattcaccgatcaacttgtc
tacttccgaccacaagttaccgggccaaaagagactgatatggtccgaatgaatggttcg
tgtattccgaatgcgtcgaaaaagatcccgggagtcgatttgatcggattgtgtatgtcg
actggaagtggtatcaaaacgtctggcgagtgcgtttgtgatagtggatattctcaaatt
gccgattcgaatggagctcggtgtgagagctgtccaacgaacacgtacaaaccaaaaggc
caatccctttgcaaatcgtgtccatccaattcgatatcttcggaagctgccagctcttgt
cgctgtcttaatggttatttcagagcagaagatgagctcatttcgatgccatgcactcaa
ccaccatcccgaccgataaaactagtggccaacgcgatcaccgccacgtcgacccgtctc
tcttggaatgagccgagcagtctgggaggtcgcccagaaatttggtatgaagtgaaatgt
tcgggacgaggagagtgtggaacagtagttatgacacctggtgataagaaactatcgaca
agatctgtgcaaatcaatgggctcagaccatcatccgactacacttttttggtgttcgcc
aagaataaggtgtctgctcagtttcccgagtttagtgagaagaatgcggttattgatatc
agaacacgatcagaagaggaagatgttccacctgtgtcacatttaagagttgatgcttct
caatccgatggaatcaccatcgcctggagtgtttcggattctgatgtttcggattttgaa
gtggaagttcgtccggcaattgtgaagaagagaactttcgaaactcgacatgttaacatg
acatataccacttttattggattaaatccagaaacggtatatcaattccgagtacgaatt
cgagatgatcttcgttggagtcaaccgatcagttatcaacttggacgaggattgatgagc
tctccgtcgtcgaatgaagtcgaagaatctcagtttttgaatcaaactggatctgcactt
ttaatcattatagctttgatacttattgtcattgcagttgctctttgtatgattgtggtg
cagaaaaagtcgaagaatcggaaacagatgagcgatttggatgttttggacacttataaa
caagattcaatgacacctgactatcatacaacatctcgacatcatcatcatcagggaaat
ctaccggctactctgcacgaacaacttcgatcgactacaaagttgaatgctccactaatt
ccatcatttggatctccaatctcccaaccaccaccatactacggtggagtacatccgaat
agtggaaaatataagacatatgtggatccaacaacatatgaagatccatatcaagcactc
atcgaattcacattcgacatttcaccaaacgacgtcttcattactcaggttattggtgga
ggagaattcggcgatgtctgcctgggtggtctgtcgaaaaactcgcctgcggccgcgaaa
tggagtgtttcaaatacaacaatgggacgaggaggaggtggtggaggatacgaatcagaa
ccatatgagacggttgccatcaaaactctgaaatctggaagcagtgcgaaagcgaaagcc
gaatttttgacggaagcaaccatcatgggacaattctcacatccaaatgtgattcggctc
attggagttgtgacgtcagcggagccagtgatgattgtggccgagtacatggcaaatgga
tctttggatcaattccttcggaatacggatcaacgaggagagaaggttcattgggagaag
atcactgaaatgttgtatggaattgcttctggaatgaagtatttgacagatatgggatat
gtgcacagagatctcgccgcccgaaacgttcttctcgacatggagcttcgctgcaaaatc
gctgattttggactttcccgtggtgtcagaagtgaaggatcttctgtcgaacccgaatac
actacaaatggcggaaagattccagtcagatggactgctccagaagcaattacccatcga
aagttcactccatcctctgatgtctggtcgttcggagttgtgatctgggaagtgtgttca
ttcggtgaacgaccatattgggattggacgaatcagaaggtgatcagcgaagtgatgatc
ggctatcgactaccaccaccgatggattgtccgatgggattgtatcggatcgcccagtgg
tgttggaagatggagcgacacgagcgtccgacgttcacacagcttctcgccacattccac
aagtacatcctgcagccgacacttattgagcatgatcctggagagcttccgcgacgggtt
cagagtcaatctgccctgaatacctatggatctgtgaatgtcggagtagttccaacccca
ccatcgtcggctgctccgatgccatcgctcgacgattttctccgtcaaattggcctaaat
catgtctacggacaactcgtgtcgaataacattcactctgtgagtgacttggccaacacg
tctcacttggatcttcttgcctatggtctcatgtccgcggagtgctcgaccgttcgggat
ggactcaacggacgcatcagtggctcaccaccgggctcttctggaacaatccacgcgacg
acacgtggaacaagaacgacgagaccgcctcgagaagagggattctttgtttag

DBGET integrated database retrieval system