KEGG   Caenorhabditis elegans (nematode): CELE_R04A9.7
Entry
CELE_R04A9.7      CDS       T00019                                 

Gene name
R04A9.7
Definition
(RefSeq) Uncharacterized protein
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04012  ErbB signaling pathway
cel04140  Autophagy - animal
cel04150  mTOR signaling pathway
cel04212  Longevity regulating pathway - worm
cel04213  Longevity regulating pathway - multiple species
cel04350  TGF-beta signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    CELE_R04A9.7 (R04A9.7)
   04350 TGF-beta signaling pathway
    CELE_R04A9.7 (R04A9.7)
   04150 mTOR signaling pathway
    CELE_R04A9.7 (R04A9.7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CELE_R04A9.7 (R04A9.7)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_R04A9.7 (R04A9.7)
  09149 Aging
   04212 Longevity regulating pathway - worm
    CELE_R04A9.7 (R04A9.7)
   04213 Longevity regulating pathway - multiple species
    CELE_R04A9.7 (R04A9.7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_R04A9.7 (R04A9.7)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CELE_R04A9.7 (R04A9.7)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   CELE_R04A9.7 (R04A9.7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C Pkinase_fungal Kdo zf-TRM13_CCCH
Other DBs
NCBI-GeneID: 3565956
NCBI-ProteinID: NP_001024829
WormBase: WBGene00044281
Ensembl: WBGene00044281
UniProt: Q21694
LinkDB
Position
X:complement(join(391636..391687,392423..393393,394431..394584,394751..394782))
AA seq 402 aa
MSGKVTENSKLTHANVVDNCDQLEKMMKQVSMQKFEKLFYPDDVAPKDFERLKLVGEGGY
GKVFQVRKQTGEDKGTIYAMKVITKRKVTGTEKDLRHARDERKILETINSPFLCDLHYAF
QTNEKLYLVLEFLHGGELYTLLERKSDWPEEYARFYLSEIILAIEHLHGHDIVYRDLKPD
NVMLNLAGHVVLTDFGLCKYKLKKGEKTLTFCGTHEYMAPEMIRKVGHDHAVDVWALGIL
MYDMFMGGPPFTGETPADKDKSILKGKVRLPPKLSASGKDLIKRIIKRDPTLRITIPDIK
EHEFFEEIDWDKLMAHDFEPPFKPTLANLEDVSHFDESFTSIAPEESPCKAIVTENEERN
YLFNGFNFNRTSKTKETRKTTSAARKLTTTNNVVTAPQLQCA
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgagcggcaaagtaaccgaaaacagtaaactaacccatgcaaatgtggtagacaattgt
gatcaattagaaaaaatgatgaagcaagtttcaatgcaaaaatttgaaaaattattttac
ccggatgacgtagcaccaaaggactttgaaaggttgaagctcgtcggagaaggaggttac
gggaaggtattccaagtgcgaaaacaaactggcgaggacaaaggaacaatttacgcaatg
aaagtaatcacaaaaagaaaagtaactggaactgagaaagacttgaggcatgccagagac
gaaagaaaaatcttggaaacaataaattcgccgttcttgtgcgacctgcactatgcattt
caaacaaatgaaaagttgtaccttgtgcttgagttcttgcacggaggagaactatacact
cttctggaaagaaaatctgattggcccgaagagtatgcaagattttatctcagtgagata
attctcgctattgagcaccttcacggccatgatatcgtctatcgagatctgaagccagac
aatgtgatgctgaatctagccggacacgtggtgctcacagatttcggactatgcaagtat
aaacttaagaaaggcgagaagacgttgacattttgtggaacacatgaatatatggcaccg
gaaatgattcgaaaagtcgggcatgatcatgctgttgatgtctgggcactcggcatcctc
atgtatgatatgttcatgggaggaccaccgtttactggagaaacacctgcggataaggat
aaaagcattttgaaaggaaaagtgagactccccccaaaactttcggcgagtgggaaagac
cttatcaaaagaattatcaagcgagacccgacgcttcgaattacaattcctgatatcaaa
gaacacgagttctttgaagaaatcgattgggataagctgatggctcatgattttgagcca
ccattcaaacctactctcgcaaatctagaggatgtctctcactttgatgaaagttttaca
agcatcgcaccggaagagtctccttgtaaagcgattgtaactgaaaatgaggaaaggaat
tatctcttcaatgggttcaatttcaatcgaacgtcaaaaactaaagaaacaagaaaaacg
acaagtgccgcaagaaaattgactaccaccaataacgtagttaccgctccccaacttcaa
tgtgcctaa

KEGG   Caenorhabditis elegans (nematode): CELE_Y47D3A.16
Entry
CELE_Y47D3A.16    CDS       T00019                                 

Gene name
rsks-1
Definition
(RefSeq) Ribosomal protein S6 kinase beta
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04012  ErbB signaling pathway
cel04140  Autophagy - animal
cel04150  mTOR signaling pathway
cel04212  Longevity regulating pathway - worm
cel04213  Longevity regulating pathway - multiple species
cel04350  TGF-beta signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    CELE_Y47D3A.16 (rsks-1)
   04350 TGF-beta signaling pathway
    CELE_Y47D3A.16 (rsks-1)
   04150 mTOR signaling pathway
    CELE_Y47D3A.16 (rsks-1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CELE_Y47D3A.16 (rsks-1)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_Y47D3A.16 (rsks-1)
  09149 Aging
   04212 Longevity regulating pathway - worm
    CELE_Y47D3A.16 (rsks-1)
   04213 Longevity regulating pathway - multiple species
    CELE_Y47D3A.16 (rsks-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_Y47D3A.16 (rsks-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CELE_Y47D3A.16 (rsks-1)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   CELE_Y47D3A.16 (rsks-1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal FTA2 Kdo Seadorna_VP7
Other DBs
NCBI-GeneID: 176554
NCBI-ProteinID: NP_499447
WormBase: WBGene00012929
Ensembl: WBGene00012929
UniProt: Q9NAH6
LinkDB
Position
III:join(11245311..11245375,11246355..11246418,11246851..11247009,11248018..11249054,11250096..11250423)
AA seq 550 aa
MADVFEFELEGHESQASPQRHAYHYDNCTEIMEDDHMYSNVADGQISAPPPSSSYMEDPM
MESIQLCASAINPPNVRVGPEDFQLLKVLGKGGYGKVFQVRKTTGSDNGQIFAMKVLQKA
TIVRNQKDTAHTKAERNILEAVKSPFICDLLYAFQTGGKLYLILEYLSGGELFMHLEREG
MFMENVAKFYLSEIVVSLEHLHQQGIIYRDLKPENILLDAYGHVKLTDFGLCKEEIEGDQ
KTHTFCGTIEYMAPEILMRCGHGKAVDWWSLGALMFDMLTGGPPFTAENRRKTIDKILKG
RLTLPAYLSNEARDLIKKLLKRHVDTRLGAGLSDAEEIKSHAFFKTTDWNLVYARQLEAP
FKPNIENDEDTSLFDARFTKMTPVDSPCETNFSLNGDNPFVGFTYVAPSVLEMMNKGGHG
GISVAHLASSMSRAGAAKSPRKPGDPETASILHGGHSNLFGHGPNSEAPQAFGYGIGSQM
TTTTAGGAGIQQPYQSFSGGYPEDDAMDTSTPRASESRETTTGNGSTTTTRPSNVGSSAS
TPIPLPKRVM
NT seq 1653 nt   +upstreamnt  +downstreamnt
atggctgacgtgttcgagttcgagctggaaggccacgagtcacaggcatcgccacagcgt
catgcatatcactatgacaactgcacggaaatcatggaggacgatcacatgtacagcaat
gttgctgatggacaaatttctgctccaccgccgagctcatcgtatatggaggatccgatg
atggaatcgattcaactgtgtgccagtgcaattaatccaccaaatgttcgtgttggaccc
gaagattttcagcttttgaaagttcttggcaagggaggatatggaaaggtattccaagtg
cgaaaaacgacgggctccgacaatggccaaatcttcgcgatgaaagtgctccaaaaagcg
acaattgtcagaaatcaaaaggatacagctcacacgaaagccgaacgaaacattcttgaa
gcagtcaagtctccgtttatttgtgatttattgtacgcatttcaaaccggtggaaaactg
tatttaatccttgaatatctatctggcggcgaattattcatgcatttggagcgagaagga
atgttcatggagaacgtcgcaaagttctatctctcggaaatcgtcgtctctctggagcat
cttcatcagcaaggaatcatctatcgagatttgaagccagagaatatccttttagacgcc
tatggacacgttaagctcacagattttggtctttgtaaggaggaaatcgagggagatcag
aagactcacacattctgtggaactatcgaatacatggcaccggagattctgatgcgttgt
ggacatggaaaagctgttgattggtggagcctcggagctctgatgtttgacatgctcact
ggtggaccaccgtttaccgctgaaaatcgccgaaaaacgattgacaaaatcctgaaggga
cggcttactctgccggcctatttgtcgaatgaggctcgagatttgatcaagaagcttttg
aaacgccatgtggatacccggctcggcgcgggtctcagtgacgcggaagagatcaaaagt
catgcgtttttcaagactacggactggaacctggtctacgcacggcagcttgaagcccca
ttcaagccgaatatagagaacgacgaggatacgtcgctgtttgacgcgcgtttcacaaaa
atgacgccggtcgattcgccgtgtgagacgaatttcagtttgaatggtgataatccgttt
gtgggattcacctatgtcgcaccgtctgtgttggaaatgatgaataagggaggacatggt
ggaatttcggtggcacatttggcttcgtctatgtcgagagctggtgctgcgaagagcccg
agaaagccaggagacccagaaacggcgagcattcttcacggtggtcactcgaatttgttc
ggtcacggaccaaatagtgaagccccacaggcttttggatacggaattggtagtcaaatg
actactactactgctggaggagcaggaattcaacagccatatcaatcatttagtggtgga
tatccagaagatgatgcaatggatacatctacaccacgtgctagtgaaagtcgtgaaact
actactggaaatggatctactacgacgacaagaccatcaaatgttggaagttctgcgtca
acacctattccattgccgaaaagggtgatgtaa

DBGET integrated database retrieval system