KEGG   Caenorhabditis elegans (nematode): CELE_R06A10.2
Entry
CELE_R06A10.2     CDS       T00019                                 

Gene name
gsa-1
Definition
(RefSeq) G protein, Subunit Alpha
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04020  Calcium signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    CELE_R06A10.2 (gsa-1)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_R06A10.2 (gsa-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_R06A10.2 (gsa-1)
   04031 GTP-binding proteins [BR:cel04031]
    CELE_R06A10.2 (gsa-1)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_R06A10.2 (gsa-1)
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_R06A10.2 (gsa-1)
  Exosomal proteins of colorectal cancer cells
   CELE_R06A10.2 (gsa-1)
  Exosomal proteins of bladder cancer cells
   CELE_R06A10.2 (gsa-1)
GTP-binding proteins [BR:cel04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    CELE_R06A10.2 (gsa-1)
SSDB
Motif
Pfam: G-alpha Arf Roc Gtr1_RagA AAA_29 TniB GTP_EFTU FtsK_SpoIIIE SNAP-25
Other DBs
NCBI-GeneID: 171687
NCBI-ProteinID: NP_001367988
WormBase: WBGene00001745
Ensembl: WBGene00001745
LinkDB
Position
I:join(1068987..1069088,1069414..1069575,1070368..1070487,1071470..1071567,1071621..1071749,1071799..1071933,1072673..1072916,1074197..1074343)
AA seq 378 aa
MRLMGCVGAGADAEGREARKVNKQIEEQLAKDKQVMRATHRLLLLGAGESGKSTIVKQMR
ILHINGFNEAEKREKITDIRRNVRDAMQVILRAMDEIVPKVSLDDPSTAISRDYILRITN
DPEDNYPSEFYDHILTCWKDKGVMACYERSSEYQLIDCAQYFLDKVDVVRQNNYDPSEQD
ILRCRVMTTGIFETKFEVDKVRFHMFDVGGQRDERRKWIQCFNDVTAIIFVCASSSYNLV
LWEDNTQNRLRESLALFKNIWNNRWLKTISVILFLNKQDLLSEKIKAKRYLLESFFPEFE
GYNLPNDAVFDNQEDKDVVRAKYFIRGEFLRISTANSDGRHHCYPHFTCAVDTENIRRVF
NDCRDIIQRIHLRQYELL
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgcgccttatggggtgcgtcggcgctggcgctgatgccgaaggccgagaagcacgcaag
gtcaacaagcagatcgaggagcagttggctaaggataagcaggtgatgcgagcgactcat
cgcctgctgcttctcggcgccggagagagcggcaagagcacaattgtgaagcagatgcgg
attctgcacatcaacggattcaacgaagccgagaagcgcgagaagatcaccgacatccgg
aggaacgttcgcgacgccatgcaggtaatcttgcgagcaatggacgagatcgtgccgaaa
gtgtcgttggacgacccgagcacggcgattagccgcgattatattcttcgaatcaccaac
gatccggaagataactacccttcagagttctacgatcacattctcacttgctggaaagac
aagggagtcatggcttgctacgagcgcagcagtgaataccagctcatcgattgtgctcaa
tatttccttgacaaagtcgacgttgtgcgacagaacaactacgatccatccgagcaggac
atccttcggtgtcgtgtcatgacaaccggcattttcgagaccaagtttgaagtggacaaa
gttagatttcacatgtttgatgttggaggtcaacgtgacgagagaagaaagtggattcag
tgcttcaatgacgtgacggccatcatttttgtgtgcgcgtcgtcttcatataatcttgta
ctctgggaggacaatacacaaaatcgcctccgcgaatccctggccctattcaaaaacatc
tggaacaaccgctggctgaaaaccatctcggtcatccttttcctcaacaaacaagacctg
ttatccgagaaaatcaaggccaagcgataccttttggagtcgttcttccccgaattcgag
ggctacaatttgcctaatgacgcggtgttcgataatcaggaggacaaggacgtcgtccgc
gccaagtactttattcgcggagagtttttgagaatatccacggcgaacagcgatggtcgt
catcattgctacccccacttcacgtgcgccgtcgacacagagaacatccgaagggtgttc
aacgactgccgagacatcatccaacgcattcatctacgacagtacgagcttctataa

DBGET integrated database retrieval system