KEGG   Caenorhabditis elegans (nematode): CELE_R10E11.3Help
Entry
CELE_R10E11.3     CDS       T00019                                 

Gene name
usp-46
Definition
(RefSeq) Ubiquitin carboxyl-terminal hydrolase 46
  KO
K11842  ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cel01002]
    CELE_R10E11.3 (usp-46)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cel04121]
    CELE_R10E11.3 (usp-46)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CELE_R10E11.3 (usp-46)
Peptidases and inhibitors [BR:cel01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   CELE_R10E11.3 (usp-46)
Ubiquitin system [BR:cel04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    CELE_R10E11.3 (usp-46)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UCH UCH_1
Motif
Other DBs
NCBI-GeneID: 176381
NCBI-ProteinID: NP_499162
WormBase: WBGene00011216
Ensembl: WBGene00011216
UniProt: P34547
LinkDB All DBs
Position
III:join(9776638..9776730,9776779..9776881,9776940..9777062,9777122..9777564,9777810..9777989,9778278..9778616)
Genome map
AA seq 426 aa AA seqDB search
MGATGSSQLEKEISTTESVNNANEHYYGLVNFGNTCYCNSVIQALFFCRPFREKVLNYKQ
TLKKSGASKDNLVTCLADLFHSIASQKRRVGTIAPKRFITKLKKENELFDNYMQQDAHEF
FNYLINTISETLIQEKIAEREKASRHGTLKKGNVTVNLAPATAGLPRSDEKGTSERNGGI
TVEGNEFLNKSDTTTWIHEIFQGILTNETRCLSCETVSSKDEDFLDLSIDVEQNTSISHC
LRVFSETETLCGDQKYFCETCSSKQEAQKRMRIKKPPQLLALHLKRFKFVEPLNRHTKLS
YRVVFPLELRLFNVSDDAEYGDRMYDLVATVVHCGATPNRGHYITLVKSNSFWLVFDDDI
VEKLEVSSMEEFSGMSTDANIQMPPGNQSAPQKNSESAYILFYQARDYAADDPNHNHKGK
NSTHSV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgggagctactggatcatcacaactggaaaaggagatcagtaccactgagtcagttaat
aatgccaatgaacactattacgggctagtaaattttggaaatacatgttactgcaactca
gtgattcaggcgttgttcttctgccggccgtttcgagaaaaagttctcaattacaagcaa
actttgaagaaatcgggcgcttcaaaggacaacttggttacgtgtctagctgatctattt
catagtattgccagtcaaaaacgaagagtaggaacaattgctccaaaacgatttattact
aaattaaagaaagaaaatgagctcttcgacaactacatgcaacaagacgctcacgaattt
ttcaattatctcattaatacaatatcggagacactaattcaagagaaaatcgcagaacga
gagaaagcgtctcgccacggaacactcaaaaaaggaaatgtcacagttaatttggcacct
gccactgcgggtcttccacgatcagatgaaaaaggaacgagtgaacgaaatggtggaatt
acggtggaaggcaacgagtttttgaataaatctgacactactacgtggattcatgaaata
tttcaaggaattttgacaaatgagacgaggtgtttgagttgtgaaactgtgtcaagtaaa
gatgaagattttctggatttatcgattgatgtggaacagaatacttcaattagccattgt
ctacgggtatttagtgaaacggagacactttgtggtgatcagaaatatttctgcgaaacg
tgctcgtcgaaacaggaagctcaaaagcgaatgcgaatcaagaaacctcctcaactgctg
gctctccatctgaaacgatttaaattcgtcgaacctctgaatcgacacacaaagctttct
tatcgagttgtatttccactggaattgcggctattcaatgtgagcgatgatgctgaatac
ggtgatcggatgtatgacctggtcgcaacagtggttcattgtggagctactccaaatcga
ggtcattatatcactttggtgaagagcaattcgttttggctggtatttgatgatgatatt
gttgaaaaactggaagtttcatcaatggaagagttctctggaatgtccacggatgcaaat
attcaaatgccacctggaaatcaatcagctcctcaaaagaattccgaatctgcctatatt
ctgttctatcaggcaagagactacgctgctgatgatccaaatcataatcataaaggaaaa
aatagtacacactccgtctag

DBGET integrated database retrieval system