KEGG   Caenorhabditis elegans (nematode): CELE_T14E8.1
Entry
CELE_T14E8.1      CDS       T00019                                 

Gene name
svh-2
Definition
(RefSeq) Tyrosine-protein kinase receptor svh-2
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_T14E8.1 (svh-2)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_T14E8.1 (svh-2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_T14E8.1 (svh-2)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     CELE_T14E8.1 (svh-2)
Protein kinases [BR:cel01001]
 Receptor tyrosine kinases (RTK)
  MET family
   CELE_T14E8.1 (svh-2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase AMA-1 Orf78
Other DBs
NCBI-GeneID: 180929
NCBI-ProteinID: NP_509104
WormBase: WBGene00020504
UniProt: H2KZU7
LinkDB
Position
X:join(6553316..6553489,6554127..6554208,6554265..6554373,6554421..6554624,6554670..6554920,6554968..6555056,6555106..6555321,6555366..6555472,6555652..6555754,6555802..6555921,6555967..6556155,6556204..6556325,6556372..6556764,6557008..6557189,6557242..6557494,6557542..6557680,6557777..6557943,6558499..6558651,6558888..6559095)
AA seq 1086 aa
MVLGSSQSSAKELTTQSSIFRFLVLLLCFTSATGGQINGKLLNGNGVFVSRDELQNKNVL
GVITGFDLLVVATHSRFQVFENNEERRTVGHVSLDMHPRTKFLELKLFSKSEIFYCDESS
CGLCTYSGVTSSCSTFMLNGDEPKIQEILSSSAVKIENLGQIMLAISFKNEEDPDNPRTM
ILRYNAQDTGTVIPTAYHADSSFIHNNHALTGFEREGFVYFVMTASQIFEPEVFLHDQSN
NKVTVTKVIRFCATDQTADLASKISILVGCDQEFRNISSRGETAVYDHANDLINIVMFNH
TSMNHLMCRFKMANIEKRFKTIWSTCQETSFSGSTAKTTRCKYPQIFDQMKVKKGCLTYS
RLDDESSPTLCVRYGRGDALDNCQLHTAKSNSYRYGWLEDYNVLQGELMMRIPYPFFGIA
ESLITDGKSYFAAVSGEFDMSDVLRFSASESADIRPHWRTNISVVGKFSITKTKENQLLY
TTVEGLQSLDISCKGLYPNCQTLRQGGWEDPLECSWCADDNAQRTITSSEVSSCKNNLKH
ECPPSMRWIHKYNNNSGFTAVVDGFRALKNPKLNACGTNCVVTVVDSSSIQCDTNPDEVI
GDSCKQVFLSGMIGDKNYSFPFDYQQADRGTQTDVKNSQVDDKKGSSPGWKIAIAIISVM
TIILIVAIIVYYMRNRFPRIKTHVRPPIGQRIENEYDMGHMAGRQAQLAINGDNYVKVFR
SMRPDLKVDFKNLRVDKLDPIGQGHYGVVYKAMYSPSKSLEEKVVCKYLKEGKISEFYEE
ARTMSEFDHPNILKLIGVALDDSSHLPIIITEYMAKGDLKSFIENVENTIKMRDLFEFAF
DIAKGMNYMHSKKFIHRDLACRNCLLDEHLRVKIADFGLCRKVDIETELYVQMHERDLPV
RWFPPEISEQGFGITSDIWSFGVVIWELFTRGSTPYSNMASWILILPWLKESETNRLRKP
PYCPEKLYTDVMLACWKANPAERPQFSDLVTIIPNVVKYMEGYDRSQLQAGYERVSSRFL
SLSRHDPAFPIYQNEMPNTPLLANCQNDTNDSKTLAELPSDSPSTSTAIPQSTPYQLLSE
CSETSV
NT seq 3261 nt   +upstreamnt  +downstreamnt
atggtactcggctcgtcgcaaagttcggcgaaggagctgaccactcaaagttccattttc
cgcttcttggtgctcttgctgtgcttcacttctgcaactggcgggcaaatcaacgggaaa
ctcctcaacggcaatggtgtttttgtgtccagagacgagctgcagaacaaaaatgtgctg
ggtgtaatcactggatttgatctacttgttgtcgctactcattcgcgatttcaggtcttt
gaaaataatgaagaacgtagaacagttggccatgtatcacttgatatgcatccacgcacc
aagtttttggaattgaagctcttctcgaaatctgaaatattttactgcgatgagtcaagc
tgcgggttatgtacatactccggtgttacatcatcgtgctcaacatttatgctgaacgga
gatgagccaaaaattcaagagatcttaagttcgagtgctgtgaaaatagagaatttaggg
caaataatgttagcaatttcatttaaaaatgaggaagatccagacaacccaagaacaatg
attttacgatataatgctcaagacactggaactgttatcccaacagcgtatcatgccgat
tcaagttttattcacaacaaccatgcccttactggttttgaaagggaaggatttgtatac
ttcgtgatgactgcaagccaaatctttgagccagaagtatttttacacgatcagtcaaat
aacaaagttacggtcacaaaagtcattagattctgcgcgacagatcaaactgcagacttg
gcatcaaaaatctcaattttagttggttgcgatcaagaatttagaaatataagttcccgg
ggtgagactgctgtttatgatcatgcaaatgatctaatcaacattgtgatgttcaatcac
acatctatgaaccacttaatgtgtcgcttcaaaatggccaacattgaaaaacgattcaaa
actatttggagtacctgccaagaaacttcattttctggcagtaccgcaaagacaacccgt
tgcaagtacccacaaatttttgatcaaatgaaggtaaaaaagggctgcttgacgtatagt
cgattggacgatgaatcatcaccaactctttgcgtgcgatatgggagaggcgatgctctg
gacaattgtcagcttcacactgccaaaagtaacagctatcggtacggatggttggaagat
tataatgttttgcaaggagagctcatgatgagaattccttatcctttctttggaatcgct
gaatctttaataactgatggaaagtcatattttgccgccgtctcgggagagtttgatatg
tcagatgttttaaggttttcggcatccgaatctgcagatattcgtccacactggagaacc
aacatctcagttgtcggaaaattctctatcacaaaaacaaaggaaaatcagctactctac
actacggtcgaaggactgcaaagtttggatatttcatgcaaagggctatatccaaattgt
cagacactgcgtcaaggtggatgggaagatcctttagagtgttcctggtgcgctgatgac
aacgcacagcgaaccattacttcttcagaagtcagcagctgcaaaaataatttgaagcac
gagtgtccaccaagtatgcgatggattcacaagtacaataataactcaggatttactgca
gttgttgatggcttccgtgcattgaaaaatccaaagttaaatgcctgcggaacaaattgt
gtagttacggttgttgattcttctagtattcaatgtgatacgaacccagatgaagtcatc
ggtgattcatgcaaacaagtatttttaagcggtatgattggggacaagaactactctttc
ccttttgactatcaacaagctgatcgagggactcaaacagatgtgaagaatagtcaagtt
gacgataagaagggtagtagtcctggatggaagatcgcaattgctattatctcggtgatg
acgattattctgattgtcgctataatcgtctactacatgaggaatcgattccccagaatt
aaaactcatgtcagaccgccaattggtcaacgtattgagaacgagtacgatatgggacac
atggctggaaggcaggctcagctagcaattaacggagacaactacgttaaagtttttaga
agcatgcgtcccgatctcaaagttgatttcaagaacctgcgcgttgacaagttggatcct
attggccaaggtcattatggagttgtctacaaagcgatgtactcaccatccaaaagtttg
gaggaaaaagttgtttgtaaatatctgaaagaaggaaaaatttcggaattttatgaggaa
gcaagaacaatgtctgagtttgaccatcccaacattctcaaactgatcggtgttgcacta
gatgattcttcccatcttccaattataattaccgagtatatggcaaaaggcgatttgaag
agctttatcgaaaacgtggaaaataccatcaaaatgagagatttattcgaattcgcattt
gacattgcgaaaggaatgaattatatgcattcgaagaagtttattcatagagatcttgca
tgcagaaattgcttattggatgagcacctccgagtcaagattgctgattttggtctctgc
agaaaagtggatattgaaacggaattatatgttcaaatgcacgaaagagacttaccagtg
cgttggttcccgccggaaatatccgaacaagggtttggcataacatccgatatctggtcg
tttggagttgttatctgggaactgttcacacgcggatctacaccgtacagcaatatggct
agttggatattgattcttccatggttgaaggaatcagagacaaacaggctacggaaacct
ccatattgtcccgagaaattatacaccgacgtgatgttggcttgttggaaagcaaatcct
gccgaacggccgcagtttagcgacctcgtgactatcattccaaacgttgtgaagtatatg
gaaggatatgatcgctcacagttacaagctggttatgagcgagtaagtagtaggtttctg
agcttgtcacgtcacgacccagcatttccaatttatcagaatgagatgccaaacacacct
ctcctagcaaactgtcaaaacgatactaacgattccaaaactcttgccgagcttccatcc
gacagtccttcaacttcaactgcaattccacagagcactccttaccaattattgagtgaa
tgctcagagacatcggtctaa

DBGET integrated database retrieval system