KEGG   Caenorhabditis elegans (nematode): CELE_T27F6.5Help
Entry
CELE_T27F6.5      CDS       T00019                                 

Gene name
pars-2
Definition
(RefSeq) Prolyl Amino-acyl tRNA Synthetase
  KO
K01881  prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CELE_T27F6.5 (pars-2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cel01007]
    CELE_T27F6.5 (pars-2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cel03016]
    CELE_T27F6.5 (pars-2)
Enzymes [BR:cel01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     CELE_T27F6.5 (pars-2)
Amino acid related enzymes [BR:cel01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   CELE_T27F6.5 (pars-2)
Transfer RNA biogenesis [BR:cel03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CELE_T27F6.5 (pars-2)
 Prokaryotic type
    CELE_T27F6.5 (pars-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b HGTP_anticodon Cecropin
Motif
Other DBs
NCBI-GeneID: 173117
NCBI-ProteinID: NP_001040689
WormBase: WBGene00004190
Ensembl: WBGene00004190
UniProt: O45869
LinkDB All DBs
Position
I:join(12487041..12487162,12487880..12488078,12488869..12489141,12489428..12489826,12490208..12490393,12490610..12490795)
Genome map
AA seq 454 aa AA seqDB search
MLFKARKWILSGASAQKSKSMAHTMLVENGFILPTAKGFYSLLPLGQRVIDKLCRILDVE
FQNSGALKIAMPIVGTQQLWEKTGRWEAMGPEMIRFHDRQQNHMCLQPTAEEMCTELIAT
LSPLKKSQFPLIVYQIGEKFRDEMNPRFGLMRGRQFLMKDMYSFSTDAETSQQTYAQIRQ
IYDRIFGEILQLDEDVIKVEADSGVHGGHISHEYHLKSSLEEDFVNFCENCKNHNKFEGP
GPAKCEKCAENSSKTVQKIPSVEIAHTFHLGTKYSEALGAKFQGKPLDMCCFGIGVTRLL
PAAIDLLSVSDKALRLPRAIAPFDAVIIVKKSLMSNVIVEMASSSASRYLKGGILLDDRV
EMSAGKRIHDANRLGIPFILVIANETERSLATQKPVIEVFTTHAKSAEPMSQGSMSLDRF
VTFVQSTLYGGGGAHDSGHLAHNQVLDQLGSHQH
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgctttttaaagcgagaaaatggattttaagtggtgcgagtgctcaaaaaagcaaaagt
atggctcatacgatgctcgtcgagaatggatttattttgccgacggcgaaaggattttat
agtctcctgcccctcggacaacgtgtaatcgacaagttgtgccgaattctcgacgtggaa
tttcagaactcgggagctctgaaaatcgcgatgccgatcgtcggaacacagcaattatgg
gaaaaaactggcagatgggaggcgatgggaccggaaatgattcgatttcacgaccgacag
cagaatcatatgtgccttcaaccaaccgccgaggaaatgtgcacagaactgatcgcaaca
ctatcaccgctcaaaaaatcacaatttccccttattgtctatcaaatcggtgaaaaattt
cgcgatgaaatgaatccgagattcggattaatgcgtgggcgtcaatttctaatgaaggat
atgtattcgttttccactgatgcggagacatctcaacaaacatatgcacagattcgtcag
atttatgatcgaatttttggagagattttgcagttggacgaggatgtgattaaggtggaa
gcagattccggagtacatggaggtcatataagtcatgaatatcacctgaaaagcagtttg
gaggaggattttgtgaatttctgcgaaaattgcaaaaatcacaacaaattcgaaggtcca
gggccggcgaaatgtgaaaaatgtgctgaaaattcatcaaaaactgtgcaaaaaatccca
tccgtcgaaattgcgcacacattccacctcggcaccaaatattcagaagctctcggagcc
aaatttcaaggaaaaccattggatatgtgctgttttggaattggtgtaacacggcttctt
ccggcggcaattgatttgttatcagttagtgataaggctctccgactgcccagagctatc
gctccgttcgatgctgtgattattgtaaagaaaagcctcatgtcgaatgtgattgtggaa
atggcgagctcgtcggcttctcgttatctaaaaggaggcattttattggacgatcgtgtg
gaaatgtcggccggaaagcgaattcacgacgcaaatcgactcggaattccatttattctc
gttattgcgaacgagacggagcggagtcttgctacgcagaagcccgtcatcgaggtattc
acgacacacgccaagtctgcggagcccatgtctcagggctcaatgagcttggaccgtttc
gtgacttttgtgcaatctacgctttatggaggtggcggagcacacgattctggtcatttg
gcacataatcaagtacttgatcaactcggatctcatcagcattga

DBGET integrated database retrieval system