KEGG   Caenorhabditis elegans (nematode): CELE_T28D6.2Help
Entry
CELE_T28D6.2      CDS       T00019                                 

Gene name
tba-7
Definition
(RefSeq) Tubulin alpha chain
  KO
K07374  tubulin alpha
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04145  Phagosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    CELE_T28D6.2 (tba-7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cel03019]
    CELE_T28D6.2 (tba-7)
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_T28D6.2 (tba-7)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cel04812]
    CELE_T28D6.2 (tba-7)
   04147 Exosome [BR:cel04147]
    CELE_T28D6.2 (tba-7)
Messenger RNA biogenesis [BR:cel03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     CELE_T28D6.2 (tba-7)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     CELE_T28D6.2 (tba-7)
Cytoskeleton proteins [BR:cel04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    CELE_T28D6.2 (tba-7)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_T28D6.2 (tba-7)
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_T28D6.2 (tba-7)
  Exosomal proteins of colorectal cancer cells
   CELE_T28D6.2 (tba-7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_3 Tubulin_2
Motif
Other DBs
NCBI-GeneID: 176568
NCBI-ProteinID: NP_499463
WormBase: WBGene00006533
Ensembl: WBGene00006533
UniProt: O18154
LinkDB All DBs
Position
III:complement(join(11368434..11368563,11369350..11369864,11370795..11370965,11371019..11371320,11371559..11371775))
Genome map
AA seq 444 aa AA seqDB search
MREVISIHVGQAGVQIGNACWELYCLEHGILPDGTSMEPDGNSGSLGTFFSDTGYGRHVP
RSIFVDLEPTVVDEIRTGAYKKLFHPEQMLTGKEDAANNYARGHYTVGKEIIDTTLDRIR
RLANNCEGLQGFFVFHSFGGGTGSGFTSMLMERLSAEYGKKSKLEFSIYPAPQISTSVVE
PYNSILTTHTTLEHSDCSFMVDNEAIYDICRRNLRVSRPTYNNLNRIISQVVSSITASLR
FDGALNVDLNEFQTNLVPYPRIHFPLVAYNPLISSAHHEFLSVDEITKSCFEASNQMVKC
DPKHGKYMAVCLLYRGDVVPKDVSAAIKSIKTQRSVQFVDWCPTGFKVGLNYQPPTVIPG
GDMAKVPRAVCMLSNTTAIAEAWQRLDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDL
AALEKDYEEVGADSDANDNGDDEY
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagtaatctcaatccacgtggggcaggcgggagttcaaatcggaaacgcttgc
tgggagctttactgcttggagcacggaattctcccagatgggacatcgatggagcccgac
gggaactccggctctctgggcacttttttctcggacactggatacggtagacacgtgcca
cgctcgatttttgtggatttggagccaactgttgtcgacgaaatccgcacgggagcctat
aaaaagttgttccacccagagcaaatgctcactggcaaagaggacgccgcaaataactac
gcccgtggccactatacagtgggtaaagagatcatcgacactactctggacagaatcaga
agactcgcgaataactgcgaaggattacaaggattctttgtgttccattcatttggtgga
ggtactggcagtggatttacctctatgcttatggagagactctccgcggagtacggcaaa
aagagcaagctcgaattttcgatctacccggctccacagatctccacctctgtcgtagag
ccctataactcaattctgacaactcacaccactttggagcactcagattgctcatttatg
gttgataacgaggcgatttatgatatctgccggaggaatttgcgggtctcgcggccaacg
tacaataatttgaatcgaattatttctcaggtagtctcctccatcacggcatctctacgc
tttgacggtgctctcaacgtggatttaaacgaatttcaaaccaatctggtcccctacccg
agaatccacttcccccttgtcgcctacaatccactgatctcttcagcccaccacgagttc
ctatcagttgatgagataacgaaaagctgctttgaagcctcaaatcaaatggtaaaatgt
gacccgaagcacgggaagtatatggctgtatgtttactgtatcgtggagacgttgtgccg
aaggatgtgtcggctgcgataaaatcgatcaaaactcagagatccgtgcagtttgtggac
tggtgtccgactgggtttaaagttggattgaactatcagccgcctacagtaatcccgggt
ggggatatggcaaaggttccacgggcggtatgtatgttgtcgaatactacggcaattgcg
gaggcgtggcagagattggactataagtttgatttgatgtatgccaagagagcttttgtg
cattggtacgttggcgagggaatggaggaaggcgagttctccgaggcacgtgaagatctg
gctgctttggagaaggattatgaggaggttggcgcggattccgatgctaatgataatggg
gatgatgagtattga

DBGET integrated database retrieval system