KEGG   Caenorhabditis elegans (nematode): CELE_W03C9.4
Entry
CELE_W03C9.4      CDS       T00019                                 

Gene name
lin-29
Definition
(RefSeq) Uncharacterized protein
  KO
K23480  zinc finger protein 362/384
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_W03C9.4 (lin-29)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cel03000]
    CELE_W03C9.4 (lin-29)
Transcription factors [BR:cel03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    CELE_W03C9.4 (lin-29)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_8 zf-C2H2_6 zf-Di19 zf-C2H2_9 zf_C2HC_14 NMD3 zf-C2HC_2 zf-C2HE
Other DBs
NCBI-GeneID: 174830
NCBI-ProteinID: NP_001122649
WormBase: WBGene00003015
Ensembl: WBGene00003015
UniProt: G5EGU6
LinkDB
Position
II:complement(join(11918339..11918546,11919472..11919637,11919678..11919781,11919831..11919931,11919993..11920166,11920502..11920654,11921391..11921477,11932008..11932081,11932868..11933059,11933116..11933224))
AA seq 455 aa
MDQTVLDSAFNSPVDSGIAGTTTGSGSTTHFGVGTNLRSSSRSTDGTDSTDGANSDNVTG
STGSTPAHHSITNLNMALSQHSIDSATAASSTNPFPHFNQADLLNFHQNSLLPHHMFSQF
GRYPQFEQKPDVGVLQQQMQMREAKPYKCTQCVKAFANSSYLSQHMRIHLGIKPFGPCNY
CGKKFTQLSHLQQHIRTHTGEKPYKCKFTGCDKAFSQLSNLQSHSRCHQTDKPFKCNSCY
KCFTDEQSLLDHIPKHKESKHLKIHICPFCGKSYTQQTYLQKHMTKHADRSKASNFGNDV
VPADPFDPSLLSWNPMQGMGDNAHDSSSFNISSLTDQFAANTMIGSQSTNYNPAFQNSAF
SQLFNIRNNRYLSEYPTSTKNGERAPGFNMITPLENIQRYNGSSSSATAVVTATGSAVVS
STPSSTSSSSAGSSSSQGGVFNPQSLINNMKNHSY
NT seq 1368 nt   +upstreamnt  +downstreamnt
atggatcaaactgttctagattcggcattcaactctccagtggactctggaatagctgga
accaccactggctccggatctaccacccattttggtgttggaacaaacttgagatcatca
agtcggtcaaccgacggcactgactcaacggacggtgccaactcggacaatgtgaccgga
tcaactggatccacaccagcacatcattcgatcactaatttgaatatggctttgtcgcaa
cactccattgactcggcaactgctgcttcatcgacaaacccgtttccgcattttaatcaa
gcggatctactgaacttccatcagaattctctcctgccacatcatatgttttcacaattt
ggaagatatccacagttcgaacaaaagccggacgtgggggtgcttcagcaacagatgcag
atgcgggaagcaaaaccttacaagtgcacgcagtgtgtcaaggcatttgccaactcatcc
tatctctcccaacacatgagaattcatcttggcatcaagccatttgggccatgtaactat
tgcggcaagaagttcactcagctatcacaccttcagcagcacattcgaacacatacagga
gagaaaccgtataagtgcaaattcacgggatgcgacaaagcattctcccagttaagcaat
ctccaatctcactctcgatgccatcaaactgataagccattcaaatgtaacagttgctat
aaatgcttcaccgacgagcagagcctcttggatcacattccgaagcacaaagagtcaaag
catctgaagattcacatttgcccgttttgcggaaaatcgtacactcaacagacttatctg
caaaagcacatgacaaagcacgcggatcgatcgaaggccagcaattttggaaacgatgtt
gttcccgcagatccatttgatccttcacttctctcatggaatccaatgcaaggaatggga
gataatgcacatgactcgtcaagtttcaacattagttctcttacagaccagtttgccgcc
aatacaatgatcggctcgcagagcacaaactacaacccagccttccagaatagtgcgttc
agtcagctctttaatattcggaataatcgatatttgtccgagtacccgacgagtacgaag
aatggagaacgagctcctgggttcaacatgataaccccactggagaacatccaacgctac
aacgggtcatcttcctcggccacggctgtcgtaacggcgaccggctcggccgtcgtctca
tcgacaccctcatccacgtcatcctcgtcagcaggttcgtcctcaagtcagggaggcgtg
ttcaacccacaatcactgataaataatatgaaaaatcattcctattaa

DBGET integrated database retrieval system