KEGG   Caenorhabditis elegans (nematode): CELE_Y49E10.2
Entry
CELE_Y49E10.2     CDS       T00019                                 

Symbol
glrx-5
Name
(RefSeq) Glutaredoxin
  KO
K07390  monothiol glutaredoxin
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cel03110]
    CELE_Y49E10.2 (glrx-5)
   03029 Mitochondrial biogenesis [BR:cel03029]
    CELE_Y49E10.2 (glrx-5)
Chaperones and folding catalysts [BR:cel03110]
 Protein folding catalysts
  Protein disulfide isomerase
   CELE_Y49E10.2 (glrx-5)
Mitochondrial biogenesis [BR:cel03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    CELE_Y49E10.2 (glrx-5)
SSDB
Motif
Pfam: Glutaredoxin
Other DBs
NCBI-GeneID: 176662
NCBI-ProteinID: NP_499610
WormBase: WBGene00013029
Ensembl: WBGene00013029
UniProt: Q9XTU9
LinkDB
Position
III:complement(join(12372637..12372861,12373638..12373841))
AA seq 142 aa
MLRVLSRQAFSMVRAANFSASASSAGGGGLSDEVRKRIDGIVKKDDVVVFMKGTQQEPAC
GFSRNVKLVLDFHNVKFQDYNVLTDQELREGVKIFSEWPTIPQVYVKGEFVGGCDILISM
HKDGEISDFLDEKGISNKYGKQ
NT seq 429 nt   +upstreamnt  +downstreamnt
atgttgcgcgtactatcacgtcaagcgttctcaatggttcgagcagccaacttctcggct
tcagcttcatcagccggtggtggcggacttagcgatgaagttcgcaaacgaatcgacgga
atcgtgaaaaaagatgatgttgtcgtttttatgaagggaacacaacaggagccagcgtgt
ggattctcgagaaatgttaaattggttctcgacttccacaatgtaaaattccaagactac
aacgttctgaccgatcaggagctaagagaaggtgtcaagattttcagcgaatggccaaca
attccacaagtctatgtgaagggagagttcgtcggcggatgtgatattctcatttcaatg
cacaaagacggagagatttccgactttttagacgaaaagggaatctcgaataaatatggg
aagcaatga

DBGET integrated database retrieval system