KEGG   Caenorhabditis elegans (nematode): CELE_Y55D5A.5
Entry
CELE_Y55D5A.5     CDS       T00019                                 

Gene name
daf-2
Definition
(RefSeq) Insulin-like receptor subunit beta
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04068  FoxO signaling pathway
cel04150  mTOR signaling pathway
cel04212  Longevity regulating pathway - worm
cel04213  Longevity regulating pathway - multiple species
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_Y55D5A.5 (daf-2)
   04068 FoxO signaling pathway
    CELE_Y55D5A.5 (daf-2)
   04150 mTOR signaling pathway
    CELE_Y55D5A.5 (daf-2)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_Y55D5A.5 (daf-2)
  09149 Aging
   04212 Longevity regulating pathway - worm
    CELE_Y55D5A.5 (daf-2)
   04213 Longevity regulating pathway - multiple species
    CELE_Y55D5A.5 (daf-2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_Y55D5A.5 (daf-2)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cel04090]
    CELE_Y55D5A.5 (daf-2)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     CELE_Y55D5A.5 (daf-2)
Protein kinases [BR:cel01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   CELE_Y55D5A.5 (daf-2)
Cytokine receptors [BR:cel04050]
 Receptor tyrosine kinase
  RTK class II (Insulin receptor family)
   CELE_Y55D5A.5 (daf-2)
CD molecules [BR:cel04090]
 Proteins
  CELE_Y55D5A.5 (daf-2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 cEGF Choline_kinase
Other DBs
NCBI-GeneID: 175410
NCBI-ProteinID: NP_497650
WormBase: WBGene00000898
UniProt: Q968Y9
LinkDB
Position
III:complement(join(2995919..2996014,2997060..2997335,2998662..2998847,2999852..3001382,3004566..3004900,3005692..3006037,3008610..3008892,3010411..3010523,3012186..3013578,3014588..3014756,3015363..3015468,3016166..3016342,3016921..3017042,3019170..3019301,3019559..3019673,3023078..3023174,3028639..3028702))
AA seq 1846 aa
MTRMNIVRCRRRHKILENLEEENLGPSCSSTTSTTAATEALGTTTEDMRLKQQRSSSRAT
EHDIVDGNHHDDEHITMRRLRLVKNSRTRRRTTPDSSMDCYEENPPSQKTSINYSWISKK
SSMTSLMLLLLFAFVQPCASIVEKRCGPIDIRNRPWDIKPQWSKLGDPNEKDLAGQRMVN
CTVVEGSLTISFVLKHKTKAQEEMHRSLQPRYSQDEFITFPHLREITGTLLVFETEGLVD
LRKIFPNLRVIGGRSLIQHYALIIYRNPDLEIGLDKLSVIRNGGVRIIDNRKLCYTKTID
WKHLITSSINDVVVDNAAEYAVTETGLMCPRGACEEDKGESKCHYLEEKNQEQGVERVQS
CWSNTTCQKSCAYDRLLPTKEIGPGCDANGDRCHDQCVGGCERVNDATACHACKNVYHKG
KCIEKCDAHLYLLLQRRCVTREQCLQLNPVLSNKTVPIKATAGLCSDKCPDGYQINPDDH
RECRKCVGKCEIVCEINHVIDTFPKAQAIRLCNIIDGNLTIEIRGKQDSGMASELKDIFA
NIHTITGYLLVRQSSPFISLNMFRNLRRIEAKSLFRNLYAITVFENPNLKKLFDSTTDLT
LDRGTVSIANNKMLCFKYIKQLMSKLNIPLDPIDQSEGTNGEKAICEDMAINVSITAVNA
DSVFFSWPSFNITDIDQRKFLGYELFFKEVPRIDENMTIEEDRSACVDSWQSVFKQYYET
SNGEPTPDIFMDIGPRERIRPNTLYAYYVATQMVLHAGAKNGVSKIGFVRTSYYTPDPPT
LALAQVDSDAIHITWEAPLQPNGDLTHYTIMWRENEVSPYEEAEKFCTDASTPANRQHTK
DPKETIVADKPVDIPSSRTVAPTLLTMMGHEDQQKTCAATPGCCSCSAIEESSEQNKKKR
PDPMSAIESSAFENKLLDEVLMPRDTMRVRRSIEDANRVSEELEKAENLGKAPKTLGGKK
PLIHISKKKPSSSSTTSTPAPTIASMYALTRKPTTVPGTRIRLYEIYEPLPGSWAINVSA
LALDNSYVIRNLKHYTLYAISLSACQNMTVPGASCSISHRAGALKRTKHITDIDKVLNET
IEWRFMNNSQQVNVTWDPPTEVNGGIFGYVVKLKSKVDGSIVMTRCVGAKRGYSTRNQGV
LFQNLADGRYFVSVTATSVHGAGPEAESSDPIVVMTPGFFTVEIILGMLLVFLILMSIAG
CIIYYYIQVRYGKKVKALSDFMQLNPEYCVDNKYNADDWELRQDDVVLGQQCGEGSFGKV
YLGTGNNVVSLMGDRFGPCAIKINVDDPASTENLNYLMEANIMKNFKTNFIVKLYGVIST
VQPAMVVMEMMDLGNLRDYLRSKREDEVFNETDCNFFDIIPRDKFHEWAAQICDGMAYLE
SLKFCHRDLAARNCMINRDETVKIGDFGMARDLFYHDYYKPSGKRMMPVRWMSPESLKDG
KFDSKSDVWSFGVVLYEMVTLGAQPYIGLSNDEVLNYIGMARKVIKKPECCENYWYKVMK
MCWRYSPRDRPTFLQLVHLLAAEASPEFRDLSFVLTDNQMILDDSEALDLDDIDDTDMND
QVVEVAPDVENVEVQSDSERRNTDSIPLKQFKTIPPINATTSHSTISIDETPMKAKQREG
SLDEEYALMNHSGGPSDAEVRTYAGDGDYVERDVRENDVPTRRNTGASTSSYTGGGPYCL
TNRGGSNERGAGFGEAVRLTDGVGSGHLNDDDYVEKEISSMDTRRSTGASSSSYGVPQTN
WSGNRGATYYTSKAQQAATAAAAAAAALQQQQNGGRGDRLTQLPGTGHLQSTRGGQDGDY
IETEPKNYRNNGSPSRNGNSRDIFNGRSAFGENEHLIEDNEHHPLV
NT seq 5541 nt   +upstreamnt  +downstreamnt
atgacgagaatgaatattgtcagatgtcggagacgacacaaaattttggaaaatttggaa
gaagagaatctcggcccgagctgctcgtcgacgacttcaacaaccgctgccaccgaagct
ctcggaacaaccactgaggatatgaggcttaagcagcagcgaagctcgtcgcgtgccacg
gagcacgatattgtcgacggcaatcaccacgacgacgagcacatcacaatgagacggctt
cgacttgtcaaaaattcgcggacgcggcgtagaacgacgcccgattcaagtatggactgc
tatgaggaaaacccgccatcacaaaaaacttcaataaattattcttggatttctaaaaag
tcatcaatgacgtcattaatgcttttactgctattcgcttttgtacagccgtgtgcctca
atagtcgaaaaacgatgcggcccaatcgatattcgaaataggccgtgggatattaagccg
caatggtcgaaacttggtgatccgaacgaaaaagatttggctggtcagagaatggtcaac
tgcacagtggtggaaggttcgctgacaatctcatttgtactgaaacacaagacaaaagca
caagaagaaatgcatcgaagtctacagccaagatattcccaagacgaatttatcactttt
ccgcatctacgtgaaattactggaactctgctcgtttttgagactgaaggattagtggat
ttgcgtaaaattttcccaaatcttcgtgtaattggaggccgttcgctgattcaacactat
gcgctgataatttatcgaaatccggatttggagatcggtcttgacaagctttccgtaatt
cgaaatggtggtgtacggataatcgataatcgaaaactgtgctacacgaaaacgattgat
tggaaacatttgatcacttcttccatcaacgatgttgtcgttgataatgctgccgagtac
gctgtcactgagactggattgatgtgcccacgtggagcttgcgaagaggataaaggcgaa
tcaaagtgtcattatttggaggaaaagaatcaggaacaaggtgtcgaaagagttcagagt
tgttggtcgaacaccacttgccaaaagtcttgtgcttatgatcgtcttcttccaacgaaa
gaaatcggaccgggatgtgatgcgaacggcgatcgatgtcacgatcaatgcgtgggcggt
tgtgagcgtgtgaatgatgcgacagcatgccacgcgtgcaagaatgtctatcacaaggga
aagtgtatcgaaaagtgtgatgctcacctgtaccttctccttcaacgtcgttgtgtgacc
cgtgagcagtgtctgcagctgaatccggtgctctcgaacaaaacagtgcctatcaaggcg
acggcaggcctttgctcggataaatgtcccgatggttatcaaatcaacccggatgatcat
cgagaatgccgaaaatgcgttggcaagtgtgagattgtgtgcgagatcaatcacgtcatt
gatacgtttccgaaggcacaggcgatcaggctatgcaatattattgacggaaatctgacg
atcgagattcgcggaaaacaggattcgggaatggcgtccgagttgaaggatatatttgcg
aacattcacacgatcaccggctacctgttggtacgtcaatcgtcaccgtttatctcgttg
aacatgttccggaatttacgacgtattgaggcaaagtcactgttcagaaatctatatgct
atcacagtttttgaaaatccgaatttaaaaaagctattcgattcaacgacggatttgacg
cttgatcgtggaactgtgtcaattgccaataacaagatgttatgcttcaagtatatcaag
cagctaatgtcaaagttaaatataccactcgatccgatagatcaatcagaagggacaaat
ggtgagaaggcaatctgtgaggatatggcaatcaacgtgagcatcacagcggtcaacgcg
gactcggtcttctttagttggccctcattcaacattaccgatatagatcagcgaaagttt
ctcggctacgagctcttcttcaaagaagtcccacgaatcgatgagaacatgacgatcgaa
gaggatcgaagtgcgtgtgtcgattcgtggcagagtgtcttcaaacagtactacgagacg
tcgaacggtgaaccgaccccggacatttttatggatattggaccgcgcgagcgaattcgg
ccgaatacgctctacgcgtactatgtggcgacgcagatggtgttgcatgccggtgcgaag
aacggtgtatcgaagattggttttgtgaggacgagctactatacgcctgatcctccgacg
ttggcactagcgcaagtcgattcggacgctattcatattacgtgggaagcgccgctccaa
ccgaacggagacctcacgcattacacaattatgtggcgtgagaatgaagtgagcccgtac
gaggaagccgaaaagttttgtacagatgcaagcacccccgcaaatcgacaacacacgaaa
gatccgaaagagacgattgtagccgataagccagtcgatattccgtcatcacgtaccgta
gctccgacacttttgactatgatgggtcacgaagatcagcagaaaacgtgcgctgcaacg
cccggttgttgttcgtgttcggctatcgaagaatcatcggaacagaacaagaagaagcga
ccggatccgatgtcggcgatcgaatcatctgcatttgagaataagctgttggatgaggtt
ttaatgccgagagacacgatgcgagtgagacgatcaattgaagacgcgaatcgagtcagt
gaagagttggaaaaagctgaaaatttgggaaaagctccaaaaactctcggtggaaagaag
ccgctgatccatatttcgaagaagaagccgtcgagcagcagcaccacatccacaccggct
ccaacgatcgcatcaatgtatgccttaacaaggaaaccgactacggtgccgggaacaagg
attcggctctacgagatctacgaacctttacccggaagctgggcgattaatgtatcagct
ctggcattggataatagttatgtgatacgaaatttgaagcattacacactttatgcgatt
tctctatccgcgtgccaaaacatgacagtacccggagcatcttgctcaatatcccatcgt
gcgggagcattgaaacgaacaaaacacatcacagacattgataaagtgttgaatgaaaca
attgaatggagatttatgaataatagtcaacaagtcaacgtgacgtgggatccaccgact
gaagtgaatggtggaatattcggttatgttgtaaagcttaagtcaaaagtcgatggatca
attgttatgacgagatgtgtcggtgcgaagagaggatattcaacacggaatcagggtgtc
ctattccagaatttggccgatggacgttattttgtctcagtaacggcgacctctgtacac
ggcgctggaccggaagccgaatcctccgacccaatcgtcgtcatgacgccaggcttcttc
actgtggaaatcattctcggcatgcttctcgtctttttgattttaatgtcaattgccggt
tgtataatctactactacattcaagtacgctacggcaaaaaagtgaaagctctatctgac
tttatgcaattgaatcccgaatattgtgtggacaataagtacaatgcagacgattgggag
ctacggcaggatgatgttgtgctcggacaacagtgtggagagggatcattcggaaaagtg
tacctaggaactggaaataatgttgtttctctgatgggtgatcgtttcggaccgtgtgct
attaagattaatgtagatgatccagcgtcgactgagaatctcaactatctcatggaagct
aatattatgaagaactttaagactaactttatcgtcaaactgtacggagttatctctact
gtacaaccagcgatggttgtgatggaaatgatggatcttggaaatctccgtgactatctc
cgatcgaaacgcgaagacgaagtgttcaatgagacggactgcaactttttcgacataatc
ccgagggataaattccatgagtgggccgcacagatttgtgatggtatggcgtacctggag
tcgctcaagttttgccatcgagatctcgccgcacgtaattgcatgataaatcgggatgag
actgtcaagattggagatttcggaatggctcgtgatctattctatcatgactattataag
ccatcgggcaagcgtatgatgcctgttcgatggatgtcacccgagtcgttgaaagacgga
aagtttgactcgaaatctgatgtttggagcttcggagttgttctctatgaaatggttaca
ctcggtgctcagccatatattggtttgagtaatgatgaggtgttgaattatattggaatg
gcccggaaggttatcaagaagcccgaatgttgtgaaaactattggtataaggtgatgaaa
atgtgctggagatactcacctcgggatcgtccgacgttcctccagctcgttcatcttcta
gcagctgaagcttcaccagaattccgagatttatcatttgtcctaaccgataatcaaatg
atccttgacgattcagaagcactggatcttgatgatattgatgatactgatatgaatgat
caggttgtcgaggtggcaccggatgttgagaacgtcgaggttcagagtgattcggaacgt
cggaatacggattcaataccgttgaaacagtttaagacgatccctccgatcaatgcgacg
acgagtcattcgacaatatcgattgatgagacaccgatgaaagcgaagcagcgagaagga
tcgctggatgaggagtacgcattgatgaatcatagtggaggtccgagtgatgcggaagtt
cggacgtatgctggtgatggagattatgtggagagagatgttcgagagaatgatgtgcca
acgcgacgaaatactggtgcatcaacatcaagttacacaggtggtggtccatattgccta
acaaatcgtggtggttcaaatgaacgaggagccggtttcggtgaagcagtacgattaact
gatggtgttggaagtggacatttaaatgatgatgattatgttgaaaaagagatatcatcc
atggatacgcgccggagcacgggcgcctcgagctcttcctacggtgttccacagacgaat
tggagtggaaatcgtggtgccacgtattatacgagtaaagctcaacaggcagcaactgca
gcagcagcagcagcagcagctctccaacagcaacaaaatggtggtcgaggcgatcgatta
actcaactacccggaactggacatttacaatcgacacgtggtggacaagatggagattat
attgaaactgaaccgaaaaattatagaaataatggatctccatcgcgaaacggcaacagc
cgtgacattttcaacggacgttcggctttcggtgaaaatgagcatctaatcgaggataat
gagcatcatccacttgtctga

DBGET integrated database retrieval system