KEGG   Caenorhabditis elegans (nematode): CELE_ZK1290.2
Entry
CELE_ZK1290.2     CDS       T00019                                 

Gene name
tph-1
Definition
(RefSeq) BH4_AAA_HYDROXYL_2 domain-containing protein
  KO
K00502  tryptophan 5-monooxygenase [EC:1.14.16.4]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00380  Tryptophan metabolism
cel00790  Folate biosynthesis
cel01100  Metabolic pathways
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    CELE_ZK1290.2 (tph-1)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CELE_ZK1290.2 (tph-1)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_ZK1290.2 (tph-1)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.4  tryptophan 5-monooxygenase
     CELE_ZK1290.2 (tph-1)
SSDB
Motif
Pfam: Biopterin_H
Other DBs
NCBI-GeneID: 174227
NCBI-ProteinID: NP_495584
WormBase: WBGene00006600
Ensembl: WBGene00006600
UniProt: G5EED8
LinkDB
Position
II:join(7549358..7549443,7549818..7549917,7549958..7550309,7550352..7550455,7550497..7550564,7550622..7550711,7550763..7550869,7550917..7551052,7551099..7551225,7551272..7551540,7551618..7551777)
AA seq 532 aa
MDSLFQMASAMKFQYYSKKAAGKTMSNSVSMSSDNRMEDFKRRFRRSGSLGIPFVPEEDV
KQLFTPTRTVRREASIREGDEEEGVQILTIIVKSSRVSEDISKMIANLPDHTRIKHLETR
DSQDGSSKTMDVLLEIELFHYGKQEAMDLMRLNGLDVHEVSSTIRPTAIKEQYTEPGSDD
ATTGSEWFPKSIYDLDICAKRVIMYGAGLDADHPGFKDTEYRQRRMMFAELALNYKHGEP
IPRTEYTSSERKTWGIIYRKLRELHKKHACKQFLDNFELLERHCGYSENNIPQLEDICKF
LKAKTGFRVRPVAGYLSARDFLAGLAYRVFFCTQYVRHHADPFYTPEPDTVHELMGHMAL
FADPDFAQFSQEIGLASLGASEEDLKKLATLYFFSIEFGLSSDDAADSPVKENGSNHERF
KVYGAGLLSSAGELQHAVEGSATIIRFDPDRVVEQECLITTFQSAYFYTRNFEEAQQKLR
MFTNNMKRPFIVRYNPYTESVEVLNNSRSIMLAVNSLRSDINLLAGALHYIL
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggattcgttgtttcagatggcatccgcaatgaagtttcaatactactcgaagaaagct
gctggaaagacaatgtctaatagtgtctccatgtccagtgacaatcgcatggaggatttt
aaacgtcgttttcgtcgaagtggatcgttaggaattccatttgtcccagaagaagatgtt
aaacaactcttcacaccaactcgtactgttcgtcgagaagcatctattcgcgaaggggat
gaggaagaaggagtacaaattctcacaataattgtcaagtcaagtcgtgtttcggaggat
atctcaaaaatgattgcaaacctccctgatcacactcgtatcaaacatttggagactcgt
gacagtcaagatggaagttccaaaactatggatgttcttctagagattgagctctttcat
tatggaaaacaagaagcaatggatcttatgagacttaatgggcttgatgttcatgaggtg
tcatcgactattcgtccaactgcaataaaagagcaatatacagagcctggatctgatgat
gcgacaaccggttctgaatggtttccaaaaagtatttatgatttggatatttgtgcaaaa
agagtgattatgtatggagcagggctggacgctgatcatcctggtttcaaagataccgag
tatcgtcaacgtcgaatgatgtttgctgaactggcgctcaattacaaacacggtgagcca
attccgcgaaccgaatatacatcatccgaacggaaaacttggggaattatatatagaaaa
ttgagagaattgcacaaaaagcacgcatgcaagcagtttcttgataactttgagctactg
gagagacattgtggatactcggaaaataatattccgcaactagaagatatctgcaagttt
ttgaaagcaaaaactggattccgtgttcgcccagtcgccggatacttatcagctcgtgat
ttcttggcaggtcttgcatatcgtgtcttcttctgcactcaatacgttcgccatcatgcc
gatccattttacactccagaaccagacaccgttcacgagctcatgggtcacatggctcta
ttcgctgatccagattttgctcagttttctcaagagattggattagcttctcttggagca
tcagaggaagatttgaagaagcttgcaacactctacttcttttccattgaatttggtctc
tcgtctgatgacgctgccgattctccagtaaaagaaaatggatcaaatcatgaaagattt
aaagtatacggagcaggacttctgagcagtgctggcgagttgcaacatgccgttgagggt
agtgcaaccattattcgttttgatccggatcgtgttgttgagcaagaatgtctcattact
actttccagtcagcgtatttctatactagaaattttgaagaggcccagcagaaactcaga
atgttcaccaacaacatgaaacgtcccttcattgttcgttacaacccatacacagaaagc
gtcgaagttctcaacaactcccgttccattatgttggcagtgaactctctccgctcagac
atcaacctgctcgccggagctctccactacatcctgtag

DBGET integrated database retrieval system