KEGG   Caenorhabditis elegans (nematode): CELE_ZK154.3Help
Entry
CELE_ZK154.3      CDS       T00019                                 

Gene name
mec-7
Definition
(RefSeq) Tubulin beta-1 chain
  KO
K07375  tubulin beta
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04145  Phagosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    CELE_ZK154.3 (mec-7)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     CELE_ZK154.3 (mec-7)
Cytoskeleton proteins [BR:cel04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    CELE_ZK154.3 (mec-7)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_ZK154.3 (mec-7)
  Exosomal proteins of colorectal cancer cells
   CELE_ZK154.3 (mec-7)
  Exosomal proteins of bladder cancer cells
   CELE_ZK154.3 (mec-7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_2 Tubulin_3
Motif
Other DBs
NCBI-GeneID: 181036
NCBI-ProteinID: NP_509313
WormBase: WBGene00003171
UniProt: P12456
LinkDB All DBs
Position
X:complement(join(7774971..7775137,7775185..7775503,7775551..7776205,7776327..7776454,7776510..7776566))
Genome map
AA seq 441 aa AA seqDB search
MREIVHIQAGQCGNQIGSKFWEVISDEHGIDPSGQYVGDSDLQLERINVYYNEAGSNKYV
PRAVLVDLEPGTMDSVRSGPFGQLFRPDNYVFGQSGAGNNWAKGHYTEGAELVDNVLDVV
RKEAESTDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDSTFCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRSNQQYRAITVPELTQQCFDAKNMM
AACDPRHGRYLTAAAIFRGRMSMKEVDEQMLNIQNKNSSYFVDWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQEAAADEDAAEAFDGE
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgagatcgttcatattcaagccggacaatgcggtaatcaaatcggttcgaagttc
tgggaggtaatatccgatgaacacggcattgacccatctggccagtatgtgggagactct
gatcttcaactcgaaagaatcaacgtctactataatgaggccggaagcaacaaatatgtt
ccaagagctgtccttgttgacttggagccaggaaccatggattctgtccgttctggacca
ttcggacaacttttccgtccagacaattacgtatttggtcaaagcggtgctggaaacaat
tgggccaaaggacactacaccgagggagcagaacttgtagacaatgttcttgacgttgtc
agaaaagaagcagaaagcacagattgccttcaaggatttcaacttactcactcacttgga
ggaggtactggatctggaatgggaacccttctcatttcaaaaattcgcgaggaatatcct
gaccggataatgaacaccttctcggtagttccaagtccaaaagtatccgacactgtagtc
gaaccctacaatgccaccctctctgtccaccagcttgtcgagaacaccgactcgacgttc
tgcattgataatgaggccttgtatgacatctgtttccgcactctgaaactgacgacaccg
acatatggagaccttaaccatctggtcagtgccacaatgagcggcgtcactacttgcctc
cgcttccctggtcaactcaatgcggatctacgaaagttggcagtgaacatggttccattc
ccacgtcttcacttcttcatgccaggattcgcaccactgactagcagaagcaatcagcag
tatcgtgccattactgtccctgagctgacccaacaatgtttcgacgcaaagaacatgatg
gctgcatgcgatccaagacatggacgttatctcaccgctgctgccattttccgaggaaga
atgagcatgaaggaggttgacgagcagatgctcaacatccagaacaagaactcttcctac
ttcgtggactggattccaaacaatgtcaagaccgcagtttgtgacattccaccaagagga
ttaaagatgtccgcaacattcatcggaaactccaccgccattcaagagctctttaagaga
atctcagagcagttcacagctatgttccgccgcaaagctttccttcattggtacactggc
gagggaatggacgagatggaattcactgaggcggagagcaacatgaacgatcttgtttcg
gaataccaacaataccaggaggcagctgctgatgaagatgccgccgaagcgttcgacgga
gagtaa

DBGET integrated database retrieval system