KEGG   Caenorhabditis elegans (nematode): CELE_ZK377.2
Entry
CELE_ZK377.2      CDS       T00019                                 

Gene name
sax-3
Definition
(RefSeq) Protein sax-3
  KO
K06754  roundabout, axon guidance receptor 2
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_ZK377.2 (sax-3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_ZK377.2 (sax-3)
   04515 Cell adhesion molecules [BR:cel04515]
    CELE_ZK377.2 (sax-3)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_ZK377.2 (sax-3)
Cell adhesion molecules [BR:cel04515]
 Immunoglobulin superfamily
  ROBO family
   CELE_ZK377.2 (sax-3)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 fn3 V-set C2-set_2 Herpes_gE fn3_2
Other DBs
NCBI-GeneID: 180637
NCBI-ProteinID: NP_741748
WormBase: WBGene00004729
Ensembl: WBGene00004729
UniProt: G5EBF1
LinkDB
Position
X:complement(join(3452496..3452572,3452618..3452927,3452982..3453116,3453230..3453978,3454038..3454325,3454379..3455172,3455231..3455447,3461318..3461703,3462336..3462499,3462705..3462965,3463510..3463865,3465770..3465842))
AA seq 1269 aa
MFNRKTLLCTILLVLQAVIRSFCEDASNLAPVIIEHPIDVVVSRGSPATLNCGAKPSTAK
ITWYKDGQPVITNKEQVNSHRIVLDTGSLFLLKVNSGKNGKDSDAGAYYCVASNEHGEVK
SNEGSLKLAMLREDFRVRPRTVQALGGEMAVLECSPPRGFPEPVVSWRKDDKELRIQDMP
RYTLHSDGNLIIDPVDRSDSGTYQCVANNMVGERVSNPARLSVFEKPKFEQEPKDMTVDV
GAAVLFDCRVTGDPQPQITWKRKNEPMPVTRAYIAKDNRGLRIERVQPSDEGEYVCYARN
PAGTLEASAHLRVQAPPSFQTKPADQSVPAGGTATFECTLVGQPSPAYFWSKEGQQDLLF
PSYVSADGRTKVSPTGTLTIEEVRQVDEGAYVCAGMNSAGSSLSKAALKVTTKAVTGNTP
AKPPPTIEHGHQNQTLMVGSSAILPCQASGKPTPGISWLRDGLPIDITDSRISQHSTGSL
HIADLKKPDTGVYTCIAKNEDGESTWSASLTVEDHTSNAQFVRMPDPSNFPSSPTQPIIV
NVTDTEVELHWNAPSTSGAGPITGYIIQYYSPDLGQTWFNIPDYVASTEYRIKGLKPSHS
YMFVIRAENEKGIGTPSVSSALVTTSKPAAQVALSDKNKMDMAIAEKRLTSEQLIKLEEV
KTINSTAVRLFWKKRKLEELIDGYYIKWRGPPRTNDNQYVNVTSPSTENYVVSNLMPFTN
YEFFVIPYHSGVHSIHGAPSNSMDVLTAEAPPSLPPEDVRIRMLNLTTLRISWKAPKADG
INGILKGFQIVIVGQAPNNNRNITTNERAASVTLFHLVTGMTYKIRVAARSNGGVGVSHG
TSEVIMNQDTLEKHLAAQQENESFLYGLINKSHVPVIVIVAILIIFVVIIIAYCYWRNSR
NSDGKDRSFIKINDGSVHMASNNLWDVAQNPNQNPMYNTAGRMTMNNRNGQALYSLTPNA
QDFFNNCDDYSGTMHRPGSEHHYHYAQLTGGPGNAMSTFYGNQYHDDPSPYATTTLVLSN
QQPAWLNDKMLRAPAMPTNPVPPEPPARYADHTAGRRSRSSRASDGRGTLNGGLHHRTSG
SQRSDSPPHTDVSYVQLHSSDGTGSSKERTGERRTPPNKTLMDFIPPPPSNPPPPGGHVY
DTATRRQLNRGSTPREDTYDSVSDGAFARVDVNARPTSRNRNLGGRPLKGKRDDDSQRSS
LMMDDDGGSSEADGENSEGDVPRGGVRKAVPRMGISASTLAHSCYGTNGTAQRFRSIPRN
NGIVTQEQT
NT seq 3810 nt   +upstreamnt  +downstreamnt
atgttcaatcgaaaaacgctgttatgcactatcctcctggtattgcaagcagtaatccga
agcttctgcgaagatgcctcaaatctcgctcccgtgataatcgaacatcccatcgatgtg
gtggtatctaggggatcgccagcaaccctcaactgtggtgcaaagccatctaccgccaaa
atcacatggtacaaggatggacagcccgtaatcacgaataaggagcaagtgaacagccac
cggattgttctcgacacgggatccctgtttcttctgaaagtgaatagtggaaaaaacgga
aaagacagcgatgcgggagcgtactattgtgtggccagcaacgagcacggagaagtgaag
tcgaacgaaggatcgttaaaattggcgatgcttcgcgaagactttcgagttcggccaaga
acagttcaggctcttggtggagagatggccgttctggaatgcagtccgccacgtggattc
ccggagccggttgtgagctggcggaaagacgacaaagagctccgaattcaagacatgcca
cgatacactctacactctgacggaaacctcatcattgatccggtcgatcgaagcgattct
ggtacttatcagtgtgttgccaacaacatggtcggagaacgggtgtccaatcccgcaaga
ttgagtgtctttgagaaaccaaagtttgagcaagaacccaaggacatgacggtcgacgtc
ggagccgcagtgctgtttgattgtcgtgtgactggagatcctcaaccacaaattacgtgg
aaacgcaaaaatgagccgatgccagttacacgtgcatacattgccaaggataatcggggg
ttgagaatcgaaagagttcaaccatcagacgaaggtgaatacgtttgctatgcacgaaat
ccagcgggaactcttgaagcatctgcacatcttcgtgtccaggcacctccatccttccag
acaaaaccagcagaccagtcagttccagctggaggcacggcaacttttgaatgcaccttg
gtcggtcaaccgagtcccgcctatttttggagcaaggaaggccaacaggatcttcttttc
ccaagttatgtgtccgctgatggtagaacgaaagtttcaccaactggaacattgacaatt
gaggaagttcgtcaagttgatgagggagcttatgtgtgcgctggaatgaactcggcagga
agctcgttgagcaaggcagctttgaaagttacaactaaagccgtgaccggaaacacaccc
gccaaaccaccaccaacaatcgagcatggtcatcaaaatcagacccttatggttggatca
tcagccatccttccatgtcaggctagcggaaaaccaactccaggaatatcatggctcagg
gatgggctacctattgacattacagatagtcgtatcagtcaacattcaacgggaagtcta
catattgccgatttaaagaaacctgacaccggagtttacacttgcattgcgaagaacgag
gatggagagtcaacatggtcggcatctctgactgttgaagatcacactagcaatgcacaa
tttgttcggatgccggatccatcgaacttcccgtcttctccaacgcaacccattattgtc
aatgtcactgataccgaagtagagctccactggaatgctccctccacatctggcgcagga
ccaatcactggttatatcattcagtactacagtccagacctcggacagacgtggtttaac
attccagactacgtggcatctactgaatatagaataaagggtctgaaaccatctcactcg
tatatgtttgtgattcgagcagaaaatgagaaaggtattggaacgccgagtgtgtcgtcg
gctctcgttaccactagcaagccagcagctcaagttgcgctttctgacaagaacaaaatg
gacatggccatcgctgagaagagactcacttcggaacaactcataaaactcgaggaagtg
aagactattaattctacggccgttcgtttgttctggaagaagaggaaacttgaagagctg
attgatggttactacatcaagtggagagggcctccaagaaccaatgataatcaatacgtg
aatgtgaccagccctagcaccgaaaactatgttgtttcaaatttaatgccattcaccaac
tatgagtttttcgtgattccttatcattccggagttcatagtattcatggagcaccgagt
aattccatggacgtgttgaccgccgaagctccaccttcattgccaccagaggatgtgcga
atccgtatgctcaacctgaccactcttcgtatctcttggaaagcaccaaaagccgacggc
atcaacggaattctcaaaggattccaaattgttattgttggtcaagcgcccaacaacaat
cggaacatcactacaaacgagagagctgccagtgttactctgttccatttagtgactgga
atgacgtataaaattcgtgtagcggctagaagcaatggtggagttggagtctcacatgga
acgagtgaagtcatcatgaatcaagacacgctggaaaaacaccttgctgctcaacaagaa
aacgaatcatttttgtatgggctgatcaataaatctcatgttcctgtgattgtcattgtt
gcaattctgattattttcgtagtcatcattatagcctattgttactggaggaatagcaga
aacagtgatggaaaggatcgaagttttataaagatcaatgatggaagtgttcatatggct
tcgaataatctttgggatgttgcacaaaatccgaatcagaatccaatgtacaacactgct
ggaagaatgactatgaacaatagaaatggccaggctctctattcgctgacaccaaatgcg
caagactttttcaacaattgtgatgactacagtggaacgatgcacagaccaggatccgag
catcactatcattatgctcaactgactggcggacctggtaatgcgatgtctactttttat
ggaaaccaatatcacgatgatccatctccatatgccaccacaacactggtcctgtcgaac
caacaaccagcttggctcaatgacaaaatgcttcgcgcgccagcaatgccaacaaatccc
gtgccaccagagccaccggcgcgatatgcagatcataccgctggaagacgatctcgatcg
agccgtgcatccgatgggagaggaactctgaatggcggactccatcaccggactagcgga
agtcaacggtcggatagtccacctcacacagatgtgagctatgttcagcttcactcatcc
gatggaactggtagtagtaaggaaagaactggggagcggagaacaccaccgaataagact
ctgatggactttattccgccaccaccttccaatccaccaccacctggagggcacgtttat
gacacagcaactaggcgtcagttgaatcgtggaagtactccacgagaagacacctacgat
tcggtcagtgacggagcttttgctcgggttgatgtgaatgcaaggccaacgagtcggaat
cggaatttgggaggaaggccgctgaaagggaaacgagacgacgatagtcagcggtcttcg
ttgatgatggacgatgatggtggatcttctgaagctgacggggagaactctgaaggagac
gttccgcgtggaggtgttagaaaagcagttcctcgaatgggtatctctgcaagtacgctg
gctcatagttgttacgggacaaacggcactgctcaacgattccggtcaattccacgtaac
aatggaatcgtcacacaagaacaaacttga

DBGET integrated database retrieval system