KEGG   Caenorhabditis elegans (nematode): CELE_ZK470.5
Entry
CELE_ZK470.5      CDS       T00019                                 

Gene name
nck-1
Definition
(RefSeq) NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family
  KO
K19862  NCK adaptor protein 2
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04012  ErbB signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    CELE_ZK470.5 (nck-1)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_ZK470.5 (nck-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:cel04990]
    CELE_ZK470.5 (nck-1)
Domain-containing proteins not elsewhere classified [BR:cel04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   CELE_ZK470.5 (nck-1)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Other DBs
NCBI-GeneID: 180690
NCBI-ProteinID: NP_508706
WormBase: WBGene00006410
Ensembl: WBGene00006410
UniProt: Q95PW9
LinkDB
Position
X:complement(join(4149066..4149260,4149841..4150026,4150096..4150260,4150308..4150622,4150680..4150757,4152543..4152674,4153303..4153419))
AA seq 395 aa
MSEDYVVVKYDYLAQEEQELTIKKNERLKLLDDSKNWWKVMNDSNSVGFVPSNYVRKESI
VDKAKGTIKGLARGRNRSSDPEPEERLNGIARLAFSLNNNCAVTPSSNKIPMMSSKTKAV
VKFTYEPRLEDELGLTKGDFVYVVEKSTDGWWKGEAPNGGVGWFPSNYVEEVEASTNGNQ
GSIENRNPAAAAVPAPIMMQAPPPKLQASRSSFEVVVALYSFDASSSEELSFKKGERLEI
VDHPEHDPDWWMARNASGTTGLVPRNYIEVVNDSSSSKASHQDFAPQYSGNGEIPMEQQP
WYFGRISRERAEDLLLHGREGEFLVRDSESNPGDLSISMRGIERNKHFKVQNVDGLLKIG
NRTFVDMNALINHYTTSPIFSSPTEKLFLTGPLPK
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgtcggaggactatgtggtcgtcaaatacgattatttagcacaagaggaacaggagttg
acgataaaaaagaacgaacggttaaagctgttagatgatagcaaaaactggtggaaagta
atgaacgattcaaacagtgttggatttgtgccttcaaactacgtgcgaaaagaatcaatt
gtggacaaagcaaaaggaacaatcaagggcttagcgcgaggtcgcaaccgatcctcagat
ccggagccggaggagcgattaaacggcatcgcgcgtctagcgttcagcttgaataacaac
tgtgcggtgacaccatcatccaataagattcctatgatgagctcgaaaacgaaagctgtg
gtgaaattcacttacgagccaagacttgaagatgagctcggtctcacaaaaggagatttc
gtttatgtcgtcgagaaaagcacagatgggtggtggaagggagaagcaccgaatggagga
gtcggatggttcccgtcaaactatgtggaggaagttgaagcttcgacaaacggaaatcag
ggaagcattgagaaccgaaacccagcagctgcagcagttccagcgcccataatgatgcaa
gcaccaccgccgaagctccaggcgtcacggtcttcatttgaagtcgtcgttgcattgtac
tcgttcgacgcatcatcatctgaagaactatcgttcaaaaaaggagaacggctcgaaatc
gtggatcatccagaacatgaccccgattggtggatggcgcgcaacgccagtggaaccaca
gggcttgtgccaagaaattacattgaggtggtcaacgactcatcatccagcaaagcttca
catcaagatttcgcaccgcaatattcaggaaacggagaaattccgatggagcaacagccg
tggtattttggacgcatctcgagggaacgtgctgaagatcttctactacatggtcgtgag
ggagagtttctggtcagagattcggagagcaatcctggagacttgtcgatctcaatgcgc
ggaatcgaacgcaacaagcatttcaaagtgcaaaacgtggatggtctcctgaaaattgga
aaccgaacgtttgtggacatgaatgctcttatcaatcactacacaaccagcccaattttc
tcgtcgccaacggagaagctgtttttgaccggtcctcttcccaagtaa

DBGET integrated database retrieval system