KEGG   Caenorhabditis elegans (nematode): CELE_ZK909.2
Entry
CELE_ZK909.2      CDS       T00019                                 

Gene name
kin-1
Definition
(RefSeq) Protein kinase domain-containing protein
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04020  Calcium signaling pathway
cel04140  Autophagy - animal
cel04213  Longevity regulating pathway - multiple species
cel04310  Wnt signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_ZK909.2 (kin-1)
   04310 Wnt signaling pathway
    CELE_ZK909.2 (kin-1)
   04020 Calcium signaling pathway
    CELE_ZK909.2 (kin-1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CELE_ZK909.2 (kin-1)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_ZK909.2 (kin-1)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    CELE_ZK909.2 (kin-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_ZK909.2 (kin-1)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cel03019]
    CELE_ZK909.2 (kin-1)
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_ZK909.2 (kin-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CELE_ZK909.2 (kin-1)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: AGC group
  PKA family
   CELE_ZK909.2 (kin-1)
Messenger RNA biogenesis [BR:cel03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CELE_ZK909.2 (kin-1)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    CELE_ZK909.2 (kin-1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 3565407
NCBI-ProteinID: NP_001368699
WormBase: WBGene00002189
LinkDB
Position
I:join(14913780..14913989,14914522..14914689,14915144..14915309,14919533..14919670,14940901..14940962,14948996..14949124,14949180..14949278,14949603..14949812,14950028..14950411,14950896..14951069)
AA seq 579 aa
MDPSPLKRRKVEDGEDRILAKCEKAADTVEIVDLSPMPLLTDEAGPSTSTNVQASQSQEQ
LQPQMDLKLRELLLSSPAHLFGLHTIPASGSNSQQPDDNNPPQAAVTSWENWLCFLATNL
SPAQWQGYWLAHCALFGDQAVPVHLLSFFQGHISPSSSSSPTSTQYLTIGPQPNDEIQER
YDMGNAASGGSSGGGGSARRGNGGGNNGSDYNNAMVFSNGRLAAAETIKEFLDKAREDFK
QRWENPAQNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEH
TLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYA
AQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAP
EIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKD
LLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKITPPSFSKGESNGRLFEA
LYPRVDGPADTRHFVEEVQEPTEFVIAATPQLEELFVEF
NT seq 1740 nt   +upstreamnt  +downstreamnt
atggacccaagcccgttgaagagaagaaaagtagaggatggtgaagataggattttggca
aaatgcgaaaaagctgctgacactgttgaaattgtcgatctatcgccaatgccattacta
actgacgaagctggaccttcaacctctacaaatgttcaagcatcacaatcacaggagcaa
ttacaaccacagatggatttgaaacttagagaactccttctttcttcaccagcacatcta
ttcgggcttcataccattcccgcaagtggctcaaacagtcagcagccagacgacaacaac
cctccacaggcagctgtaacaagttgggaaaactggttatgctttttggcaaccaactta
tcaccagctcagtggcagggctactggcttgcacattgtgcattatttggagatcaagca
gttcccgttcatctcctcagcttcttccaaggacacatctcaccgtcgtcttcttcatcg
ccaacatccacgcaatatttgacaattggaccacaaccaaatgacgagattcaggaaaga
tatgatatgggaaatgcggcatctggcggatcttctggaggtgggggatcggcacgacgt
ggaaacggtggcggaaacaacggtagtgactataacaatgcgatggttttctcgaatgga
cgtttagccgcggcagagacaatcaaagaattcctggacaaggcacgcgaagacttcaaa
caacgatgggagaatccggctcagaacacggcgtgtcttgacgactttgataggataaaa
acccttggaaccggatcattcgggcgcgtgatgcttgtgaagcataagcagtcgggcaac
tattatgccatgaaaattctagacaaacaaaaggttgtaaaactcaagcaagtggagcac
acgttgaacgaaaagcgcattctccaggctatcgattttccgtttttggtgaacatgacg
ttctctttcaaggacaactccaacttgtacatggtgctcgaattcatctcgggaggtgag
atgttctcacatttacgccgaatcggacgtttctccgagccccactcgcgtttctacgcc
gctcaaattgtgcttgcctttgagtaccttcactccttagatctcatctatcgtgatctg
aaacccgagaacttgcttatcgattccactggatatctaaagatcaccgatttcggattt
gcgaaacgtgtcaaaggacgaacgtggacattgtgcggcacaccagaatacttggcaccc
gagattattttgtcaaaaggatacaataaggctgtcgattggtgggcacttggtgtgttg
atctacgaaatggccgccggttatccgccgttctttgccgatcagccgattcaaatttat
gagaagattgtgtcaggaaaagtgaaattcccgtcgcacttctcgaatgagttgaaagac
ttgctgaagaatttgctccaagttgatcttacaaagcgatacggtaacctgaaaaatgga
gttgccgatatcaaaaatcacaagtggtttggaagtaccgactggattgccatctatcag
aagaagatcacaccgccctcgttctccaaaggagaatccaatggtcgactgttcgaggct
ctgtatccacgtgtcgatggtcccgccgacacacgtcattttgtggaagaggtgcaagag
ccgactgagtttgtgatcgccgcgactccacagttggaagagctgttcgtcgagttttag

DBGET integrated database retrieval system