KEGG   Cellvibrio sp. PSBB006: CBR65_00050Help
Entry
CBR65_00050       CDS       T04891                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cell  Cellvibrio sp. PSBB006
Brite
KEGG Orthology (KO) [BR:cell00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CBR65_00050
Enzymes [BR:cell01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CBR65_00050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like DAO Glutaredoxin FAD_binding_3 NAD_binding_7 AlaDh_PNT_C Thi4 K_oxygenase FMO-like Thioredoxin_9 Thioredoxin_4 Shikimate_DH NAD_binding_8 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ARU25950
UniProt: A0A1Y0FRD6
LinkDB All DBs
Position
complement(9631..11184)
Genome map
AA seq 517 aa AA seqDB search
MLDSTIKGQLKAYLEKLQRPIELVATTDTSAKSQELLTLLDDIATLSDKVSVRKDGDAAY
KPSFSVGAQGETGRIHFAGIPMGHEFTSLVLALLHSGGHPPKTDAKVIEQIKAIDGQFHF
EVFVSLSCHNCPDVVQAVNLMAALNPNITATMIDGALFQSEVDKRQVMAVPTVFVNGEHF
GQGRMTVEEILAKIDTGAAEREAKALSEKPAYDVLVVGGGPAGAAAAIYAARKGIRTGVV
AERFGGQVLDTLAIENFISVKETEGPKLASALEQHVKEYDVDIVNLQRAEQLIPGEMIEV
KLASGASLKSKSVILATGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGGN
SGVEAAIDLAGIVAHVTLIEFDSKLRADAVLQRKLTSLPNVTVITEALTTEVLGDGQKVN
ALTYKSRQTDDIIKVELEGIFVQIGLLPNTDWLKGTLQLSNRGEIEIDARGQASIPGVFA
AGDCTTTPYKQIIVAMGAGATASLGAFDHLIRTSAPA
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctcgattcgacaattaaaggccagctgaaagcgtatctggaaaaactgcaacgccct
attgaactggtcgccaccactgacaccagtgccaaaagccaggaattgctgaccctgttg
gacgatatcgccaccttgtccgataaagtcagcgttcgcaaagatggtgatgccgcgtac
aaaccttccttcagtgtcggcgcacaaggcgaaaccgggcgtattcatttcgccggtatt
cccatgggccacgaatttacctcgctggtgcttgcgttattgcacagcggtggccatccg
ccaaaaacggatgccaaggtcatcgagcaaattaaagcgatcgatggtcaatttcatttt
gaagtctttgtttccctgtcatgccacaattgtccggacgtggtgcaagccgtgaattta
atggccgcattgaaccccaacatcactgccaccatgatcgacggcgccttgtttcaaagc
gaggtggataaacgccaagtcatggctgtgcccaccgtgtttgtgaacggcgaacacttt
ggccagggccgcatgacggtggaagaaatccttgccaaaatcgacaccggcgcagccgaa
cgcgaagccaaagccctgagcgaaaaaccggcttacgatgtgttagttgtcggtggtggg
cccgctggcgcagcggctgcgatctatgcagcgcgcaagggtattcgcaccggcgttgta
gccgaacgtttcggcggacaagtgctcgatacactcgctatcgaaaattttatttcagta
aaagaaaccgaaggcccaaaactggcttcggcgctggagcaacacgttaaagaatatgac
gtggatattgtgaacctgcaacgcgcagagcaattgattcccggcgagatgattgaagtc
aagctggccagcggcgccagcttgaaaagcaaaagtgtaattctcgcgaccggcgcacgc
tggagagagatgaacgttcccggcgaaaaagaatatcgtggtaaaggcgttgcctattgc
ccacactgcgatggtcctttattcaaaggcaaacgcgtcgcagtgattggcggcggcaat
tccggtgtagaagctgccattgatttggccggtatcgttgctcatgtcacgctgattgaa
tttgattcaaagctgcgtgccgatgcggtgctgcaacgtaaattaaccagcttgcccaat
gtcaccgtcattaccgaagcactgactacagaagtgctcggtgatggtcaaaaggtcaat
gcattgacttacaaaagtcgccagactgatgacatcatcaaagtcgaactggaaggtatc
tttgtgcagatcggtttgttacccaataccgattggttgaaaggcactctgcaactgagc
aatcgcggtgagattgaaattgatgcacgcggtcaggcttccattcccggtgtgtttgcc
gcgggtgactgtactaccacaccctataaacaaattattgttgcgatgggtgccggtgca
accgcttcattgggtgcgtttgatcatttgatcaggaccagtgcgccggcttaa

DBGET integrated database retrieval system