KEGG   Cellvibrio sp. PSBB006: CBR65_02335Help
Entry
CBR65_02335       CDS       T04891                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
cell  Cellvibrio sp. PSBB006
Pathway
cell00020  Citrate cycle (TCA cycle)
cell00270  Cysteine and methionine metabolism
cell00620  Pyruvate metabolism
cell00630  Glyoxylate and dicarboxylate metabolism
cell00680  Methane metabolism
cell01100  Metabolic pathways
cell01110  Biosynthesis of secondary metabolites
cell01120  Microbial metabolism in diverse environments
cell01130  Biosynthesis of antibiotics
cell01200  Carbon metabolism
Module
cell_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cell_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cell_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cell00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CBR65_02335
   00620 Pyruvate metabolism
    CBR65_02335
   00630 Glyoxylate and dicarboxylate metabolism
    CBR65_02335
  09102 Energy metabolism
   00680 Methane metabolism
    CBR65_02335
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CBR65_02335
Enzymes [BR:cell01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     CBR65_02335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: ARU29907
UniProt: A0A1Y0G2R3
LinkDB All DBs
Position
509729..510712
Genome map
AA seq 327 aa AA seqDB search
MKAPVRVTVTGAAGQISYSLLFRIAAGDMLGKDQPVILQLLEITPALKALQGVAMELDDC
AFPLLTDIICTDDPNVAFKDTDYALLVGARPRGPGMERKDLLSANAAIFSVQGKAINDHA
SRNIKVLVVGNPANTNALIAQRNAPDIDPRQFTAMTRLDHNRGLSQLAAKTGKSINDITR
LTIWGNHSSTQYPDLHQAKVDGKDAMGLIDQAWYEADYITTVQQRGAAIIAARGASSAAS
AANAAIFHMRDWALGTPDGDWVSMGVYSDGSYGIEKGLIYSFPCVCKNGDWEIVQGVSVN
DFSRGKMQATEKELQEERDAVKELLPA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcacccgtaagagttaccgtcactggcgctgctggccaaatcagctattccctc
ctgttccgcatcgctgctggcgatatgctgggcaaggaccaacccgtgattctgcaattg
ctggagatcaccccggcgctgaaagccctgcagggcgtagcgatggagctggacgactgt
gccttcccattgctgaccgatattatctgtaccgatgaccctaacgtagcgttcaaagat
actgactacgcattgctcgtcggtgctcgtccccgtggcccgggcatggagcgtaaagac
ctgctgtcggccaacgccgccatcttctctgtacaaggcaaggctatcaatgatcatgcc
tcacgcaacattaaagtgctggtcgtgggtaaccctgctaacaccaacgccttgatcgct
caacgcaatgcaccggatatcgaccctcgtcaattcactgcgatgacccgtctggatcac
aatcgtggcttgagccaactggctgccaagactggcaagagcatcaacgacatcaccagg
ttgaccatttggggcaaccactcgtcgacccagtatcccgacctgcatcaagccaaagta
gatggcaaagacgctatgggcttgattgaccaggcgtggtacgaagcggattacatcact
accgttcaacaacgtggtgcggctattattgctgcacgtggtgcatcttctgcggcctct
gcggccaacgcagcgatcttccacatgcgcgactgggcgttgggcacaccggatggcgac
tgggtcagtatgggcgtgtacagcgatggcagctatggcattgagaagggcctgatctac
tcattcccgtgcgtatgtaaaaacggcgattgggaaatcgtgcaaggcgtttctgttaac
gacttttctcgtgggaagatgcaagcgactgagaaagaattgcaggaagagcgcgacgcg
gttaaggaattattgcccgcgtaa

DBGET integrated database retrieval system