KEGG   Cellvibrio sp. PSBB006: CBR65_07780Help
Entry
CBR65_07780       CDS       T04891                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
cell  Cellvibrio sp. PSBB006
Pathway
cell00061  Fatty acid biosynthesis
cell00780  Biotin metabolism
cell01100  Metabolic pathways
cell01212  Fatty acid metabolism
Module
cell_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cell00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CBR65_07780
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CBR65_07780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cell01004]
    CBR65_07780
Enzymes [BR:cell01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CBR65_07780
Lipid biosynthesis proteins [BR:cell01004]
 Fatty acid synthase
  Component type
   CBR65_07780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT_2 MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-ProteinID: ARU27346
UniProt: A0A1Y0FVS1
LinkDB All DBs
Position
complement(1889432..1889869)
Genome map
AA seq 145 aa AA seqDB search
MMDVNEIREYLPHRYPFLLVDRVIELVEGESIIAYKNITVNEEVFNGHFPQAPIFPGVLI
IEAMAQASGILGFKSAKKKPQDGSIYLFAGVDDVRFKRQVIPGDRLQLESRVVSEKRGIW
KFECRATVDGALAASATILCADRKI
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgatggatgtgaatgaaatacgcgaatacttacctcatcgttatccatttttattggtc
gatagagtcatagagctggtggagggcgaatcaatcatcgcctacaaaaacattacagtg
aatgaggaagtcttcaacggtcattttccgcaggcaccgattttccccggcgtcctgatc
attgaggctatggctcaggcttccggaattctcggttttaaaagtgccaaaaagaaaccg
caagatggctctatatacctgtttgcgggagtggatgatgtgcgcttcaagcgtcaggta
attcccggtgaccgtctgcaactggaatcccgtgtcgtctcggaaaagcgtgggatatgg
aaattcgagtgccgtgcaacggtcgacggtgcgttggctgcatcggcaacaatactttgt
gccgatcgcaaaatctga

DBGET integrated database retrieval system