KEGG   Cellvibrio sp. PSBB006: CBR65_12580Help
Entry
CBR65_12580       CDS       T04891                                 

Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
cell  Cellvibrio sp. PSBB006
Pathway
cell00500  Starch and sucrose metabolism
cell01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cell00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CBR65_12580
Enzymes [BR:cell01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CBR65_12580
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CBR65_12580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ARU28194
UniProt: A0A1Y0FYG9
LinkDB All DBs
Position
complement(3022282..3025605)
Genome map
AA seq 1107 aa AA seqDB search
MASKAKTATFLKDPLWYKDAVIYQVHIKSYFDANNDGSGDFPGLIEKLDYIAELGVNTIW
LLPFYVSPRRDDGYDIAEYRSVHPEYGTMADARRFLKEAHKRGLRVITELVINHTSDQHP
WFQRSRRAKKGSKWRDFYVWSDTNQKYQGTRIIFSDTENSNWTWDPIAGQYFWHRFYSHQ
PDLNFDNPAVLKEVLSIMSFWFDLGVDGLRLDAIPYLVEREGTLNENLPETHDVLKQIRA
ELNQNYPDRMLLAEANLWPEDIQQYFGNGDECHMAFHFPLMPRMYMAIAQEDRFPMTDIL
RQMPEIPDNCQWAIFLRNHDELTLEMVTDDERDYLWEYYASNRRARLNLGIRRRLAPLVE
RDRRRIELLHSLLLSMPGTPTLYYGDEIGMGDNLFLGDRHGVRTPMQWSIDRNGGFSRAD
PASLASPPIMDPLYGFQTVNVESQAVDPHSLLNWTRRMLVVRKQQKAFGRGTLKMLAPTN
RRIFAYLREYTGPDGDHELILCVANLSRSAQAVELDLAAYAGKVPVEMIGGSSFPPIGQL
SYLLTLPPYGFYWFLLADEAQMPNWYVPPVEPMPDLPPLIIKKDLSELLQTPNITVLEHE
SLPDYISRRHWFFHRGRQPEDGDLHLSYLIPFGEPGKKYALAEVEIRYDSGSEHYQLPLG
YVAEKREGSAIPQQLAMARLRQGRQVGLLTDAATLTGFAREVVQDMRRHQVLALEGSEVQ
FIPAPELQQFKESVESTEEDISFSTAEHANSSIAIDETMLLKLFRRIVPGIHPEVEMGRF
LTERGFTHTAPFLGEVRRVDPRGETYTLMVLQGYLSNQGDAWQWTQNTLERAVRDQLAAG
DSSIENEATALAELDAFARILGRRLGELHQTLAQPSDNPDFDLVITSEADVVVCQDEARQ
QMEIALRMLDEHRHELSGNEALLAENLLTRREQILARLDQLALGSLGGVMQRVHGDLHLG
QVLVVQDDAYFIDFEGNTHLSLAERRRRQSPLKDVAGMLCSFDYAAAMILRNPGGVDDSP
EAETARRSMVTSYLQHARRGFLDAYRVAAADVPHEWVERDGEDNALRFHRLDTAAHQVIA
ECHDRPDWLAVPLQGLASLVEHLGLKE
NT seq 3324 nt NT seq  +upstreamnt  +downstreamnt
atggctagcaaggcaaaaaccgcgacatttctcaaagacccgctgtggtacaaggacgcg
gtgatttatcaggttcacatcaaatcctatttcgatgccaacaatgatggctccggggat
ttccccggcctgattgagaaactggactacatcgccgagctgggcgtcaacaccatctgg
ttactgccgttctatgtatcgccgcgccgcgacgacggttatgacattgctgaataccgc
agcgtccaccccgaatacggcaccatggccgacgcacgccgctttctgaaagaagcccac
aaacgaggtttgcgggtgatcaccgaattggtcatcaaccacacctcggatcagcatccc
tggttccagcgctcccgccgggccaagaagggctccaaatggcgcgacttctacgtctgg
tccgacaccaatcagaagtatcaaggtacgcgcatcatcttctccgataccgaaaattcc
aactggacctgggacccgattgccggccagtacttctggcaccgcttctactcccaccaa
cccgatcttaatttcgacaatccggcggtgctgaaggaagtcctgagtatcatgagtttc
tggtttgatctgggtgtggatggcctgcggctggacgcgattccttacctggtggagcgc
gaaggcacgctcaatgaaaacctgccagagacccacgatgtcctcaagcagatccgcgcc
gagctgaaccagaattacccggatcgtatgctgttggccgaggccaatctctggcccgaa
gatatccagcaatacttcggcaatggcgatgaatgccatatggccttccacttcccgctg
atgccgcgcatgtacatggccatcgcccaggaagaccgctttcccatgaccgatatcctg
cggcagatgccggagatcccggacaactgccaatgggctatcttcctgcgcaaccacgat
gagctaaccctggagatggtgaccgacgacgagcgggactatctctgggagtactacgcc
tccaatcgccgcgcccggttgaacctgggcattcgccgccgtctggcgccgttggtggag
cgggaccgccgccgcatcgagctcttgcacagtttgctgctgtccatgcccggcacgccg
acgttgtattacggcgatgaaatcggcatgggcgacaacctgttcctcggcgaccgccac
ggcgtgcgcacgcccatgcaatggtctatcgaccgcaacggcggtttttctcgcgccgac
ccggccagtctcgcttcgccgccgatcatggacccgctctacggtttccagacggtcaac
gtggaaagtcaggccgttgacccgcattcgctactcaactggacccggcgcatgctggtg
gtgcgcaagcaacagaaagcctttggtcgcggtacgctgaagatgttagcgcccaccaac
cgacgcatctttgcctatctgcgtgagtacacgggtccggacggcgatcatgagctgatc
ctgtgtgtggccaacctgtcgcgctcggcccaggcggtggagctggatctggcagcttat
gccggcaaggtaccggtggagatgatcggcggctcttcgtttccacccatcggccagctc
agttacctgctgaccttaccgccctatggtttctattggtttctgctggcggacgaagcg
cagatgcccaactggtatgtaccgccggtagaacccatgcccgacctgccgccgctgatc
atcaagaaagacctgtcggagctgttacagacacccaatatcaccgtgctggaacatgag
tccttgccggattacatctcccgccgccactggttcttccatcgcggacgccagccggaa
gacggcgatctgcatctgagttacctcatacccttcggcgaaccgggcaagaaatatgcg
ctggctgaagtggagatccgctacgacagtggcagcgagcactaccagttaccgcttggt
tatgtcgcggagaagcgtgagggcagcgcgattccccaacaactggctatggcgcgcttg
cggcagggccggcaggtggggttgttgaccgatgccgcgaccctcaccggctttgcacgg
gaggtggtgcaggacatgcgccgccatcaggtactggcgctcgaaggcagtgaagtgcag
tttattccggcgccggaactacagcagttcaaggaatcggtggaaagcaccgaggaagac
atcagttttagcaccgcagaacatgccaacagttcgatcgccatcgacgaaaccatgctg
ctgaaactcttccgccgcatagtgccgggcattcacccggaggtggagatgggacgcttc
ctcaccgagcgcggctttacccacacagcccccttcctcggcgaggtgcggcgggttgat
ccgcgcggcgagacatacaccctgatggtgttgcagggttatctgagcaatcagggcgac
gcctggcagtggacgcagaataccctggagcgcgcggtgcgcgaccaattggcggcgggc
gactccagtattgaaaatgaagcgacggcgctggcagagctggacgcctttgcgcgcatt
cttggccgccgcctcggtgaattacaccagacactggcgcaaccctcagataaccccgac
ttcgatctggtgatcaccagcgaagccgatgtggtggtatgccaggacgaggcccgtcag
caaatggaaatcgcgttgcgtatgctggacgaacaccgccatgagctatccggcaacgag
gcgctgctggccgagaacctgctgacccggcgcgaacagatactggcgcgactggatcaa
ctggccctgggttcgctgggcggtgtcatgcagcgggttcacggtgacctgcatctgggc
caggtattggtggtacaggacgatgcctactttatcgactttgaaggcaatacccatctc
agtctggccgagcgacgccgccgccaaagccccctgaaagatgtagcgggcatgctgtgt
tcctttgactatgccgccgccatgatcctgcgcaaccccggcggtgtggatgattccccg
gaagcagaaaccgcgcgccgctccatggtaaccagctacctgcaacatgcgcggcgcggc
ttccttgatgcctatcgcgtggcggccgccgatgtgccccacgaatgggttgagcgggat
ggcgaggacaacgcgctgcgcttccaccgtctcgacaccgctgcccatcaggtgatcgcg
gagtgtcacgaccgcccggattggttagccgtgccacttcaggggctggcaagtctggta
gagcatttagggttgaaggaataa

DBGET integrated database retrieval system