KEGG   Cellvibrio sp. PSBB006: CBR65_15925Help
Entry
CBR65_15925       CDS       T04891                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cell  Cellvibrio sp. PSBB006
Brite
KEGG Orthology (KO) [BR:cell00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cell01001]
    CBR65_15925
Enzymes [BR:cell01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CBR65_15925
Protein kinases [BR:cell01001]
 Serine/threonine kinases: Other
  Bacterial family
   CBR65_15925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal Exosortase_EpsH Kdo TPR_2 Nterm_IS4 TPR_14
Motif
Other DBs
NCBI-ProteinID: ARU28808
UniProt: A0A1Y0FZK5
LinkDB All DBs
Position
3821602..3823992
Genome map
AA seq 796 aa AA seqDB search
MRSILQACINFFDLRLLVWVPGLWLILSAVTPTFLAQLDKQLFFTGASLSRGIQRPPVID
ILELSSTQMRQLMDDPGQNPDVLLLLDYLNKKQQRTGIILNDLPRPIVLPIDAAPVSDVT
PSPADTAWQNRRAAQQALQRWLTSPAVIIGSETLSPMLASKQQLAVTEPRWMMYYQWLPA
SMQPPLFPAAPPLESVTMPWQIFPVPAINFQENDVQQALLWQHEGDWYPSMALALLPVQD
NLVWRGRSELHGASLGRLYTNIDGSVIPVFQAQGPFPPVTSHYTLQRFLQQRSEEPSPLL
LIGTAGDSSLLSLAGFMQSLYTDNYHTSPWWFYGAEKLLLLLTLVYLLWALPRMSGGVAL
LATLLCLLLLVVVQLGGQITQSRWLPLGLTMQYLLWGFLVMALWRQQQKPHKRLQQRHQE
VACQLSQQYMHQGQLDQALKALDDCVTSERVLQLLYDIGGQHERKRRVNEALAAYRVLYK
RHRSFKDVAKRLKQLTDKQHSPAEDIELALSKTVVLADPHSRPQFGRYNIEREIGRGAMG
VVYLGHDPQIARRVAIKTLDYSRYDTGELAAVKTRFFREAEAAGRLRHPNIVTVYDVGEE
HDLAFIAMDYVAGQPLSNFIAPKNLLPIAQVYRIVADVAEALAYAHSRQIVHRDIKPGNI
LYHPDSKKVTVTDFGIARIVSDARTQTGEIIGSPLYMSPEQVKGQKVGEASDIFSLAVTF
FQLLSGELPFHGDNIAGLSYQIIHGKHKNIRDLRSQIPTSASRIINKALQKEPGERYGNA
TDMARSLRKALQKDFA
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgcgatctatcttgcaagcgtgcataaatttttttgatttgcgtttactggtgtgggtg
ccagggctttggcttatcctgagcgcggtcacgccaacattcctggcgcagcttgataaa
caattattttttaccggtgcgtccttatcgcgcggcatccaacgtccgcccgttattgat
attctggaactttcttcgacgcaaatgcggcagctgatggatgatccgggccagaacccg
gacgtgttattactgctggattatttaaataaaaaacaacaacgcaccggcattattctc
aatgatttaccgcgccctattgtcttgccgattgatgccgcaccagtctctgatgtaacg
ccgtcacctgccgatacggcttggcaaaatcgccgtgcggcgcagcaggcattgcagcgt
tggcttacgtctcccgcggtcattatcggcagcgaaacattatcgcccatgctcgcgtcg
aagcaacagctagcggtgacggaaccgcgttggatgatgtattaccaatggttgcccgcc
agcatgcaaccgccgctgtttcccgccgcgccgccattggaatccgtcaccatgccgtgg
caaatttttccagtgcctgccataaattttcaggaaaatgatgtgcagcaagccttgctt
tggcagcacgagggcgattggtatccgagcatggcgctggcattgttgccagtgcaggac
aatctggtctggcgtggccgaagcgaattacatggcgcgtccctggggcgcttgtacacg
aacattgacggtagcgtgataccggtattccaggcgcagggtccctttccgccggtcacc
agtcattacaccttgcagcgttttctgcaacagcgcagcgaagaaccgtcaccgttattg
ttgatcggcactgccggcgatagctcgctgttgtcgctggcgggattcatgcaaagctta
tacaccgataattatcatacctcgccctggtggttttacggtgcggaaaaattattgctg
ttgttgacgctggtgtatctgttatgggccttgccgcgtatgagcggcggtgttgccttg
ctggcaaccctgctctgtttattgttgttggtggttgtgcaattgggtggacagattacc
caatcgcgttggttgcccttggggctgaccatgcaatatttactgtggggttttctggtg
atggcgctgtggcgacaacaacaaaaaccgcacaaacgtttgcagcagcgtcaccaggag
gtggcttgccaattgagtcagcaatacatgcatcaagggcaattggatcaagcgctaaaa
gccctggatgattgcgtgacatctgagcgggttttgcaattgttgtacgacatcggcggg
caacatgaacgcaagcggcgcgtcaacgaagctttggccgcgtatcgtgtgttgtataaa
cgccatcgttcattcaaggacgtggccaaacgattaaaacagttaaccgacaaacagcac
tcgcccgccgaagatatcgaactggcgctgagcaaaacggtggtgctcgccgacccgcac
agccgtccgcagtttggccgttacaacattgagcgcgaaatagggcgcggtgccatgggc
gtggtgtacctcggtcacgatccacaaattgcacggcgagtggcaattaaaactctggat
tactcacgttatgacacgggtgaactcgctgcggttaaaacgcgtttttttcgtgaagcg
gaagccgccgggcgtttgcgtcacccgaacattgtgacggtttacgatgtaggtgaagaa
catgacttggcgtttatcgcgatggattatgtcgcgggccaacccttgagtaattttatt
gcaccgaaaaatttactgccgattgcgcaggtgtaccgcatcgtggccgacgtagcagaa
gcgctcgcctatgcgcacagccgacaaattgtgcatcgtgatatcaagccgggcaacatt
ctttatcacccggacagcaagaaggtgacggttacggatttcggtatcgcgcgtatcgtg
agcgatgcacgcacacaaaccggtgagattatcggcagccccttgtatatgtcgcccgag
caagtgaaaggccagaaggtgggcgaggccagcgatatcttcagtctggcggtgaccttt
ttccaattactcagcggtgagctgccctttcacggcgataacatcgctggcttgagttat
cagatcatccatggcaaacataaaaatattcgtgatctgcgttcacaaattcccaccagt
gccagccgtataatcaacaaggcactgcaaaaggaaccgggggagcgttacggcaacgcc
accgacatggcgcgttcgctacgcaaggcattacaaaaagattttgcctga

DBGET integrated database retrieval system