KEGG   Cellvibrio sp. PSBB006: CBR65_17305Help
Entry
CBR65_17305       CDS       T04891                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
cell  Cellvibrio sp. PSBB006
Pathway
cell00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cell00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CBR65_17305
Enzymes [BR:cell01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     CBR65_17305
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CBR65_17305
Glycosyltransferases [BR:cell01003]
 Polysaccharide
  Bacterial polysaccharide
   CBR65_17305
Peptidoglycan biosynthesis and degradation proteins [BR:cell01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   CBR65_17305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ARU29055
UniProt: A0A1Y0G1E2
LinkDB All DBs
Position
4179821..4182163
Genome map
AA seq 780 aa AA seqDB search
MTKRRSISRTKKSPPPSKPPRHGWALFRLWLFYSVIAILVLLAIWTLYLDVVVRAKFDGK
KWALPARVYSRPLELYEGLALTPPLFEQELQALGYRAVGSLNAPGQYVKRPVSSVQASYQ
VHSRGFDFWDKREEARRFGITIADGHVLHLRDLAGADMPLMRLEPEEIGGIYPAEAEDRL
LVRLSDLPPLLGETLLAVEDQHFLDHYGVSPLAILRAAMVNVREGEVVQGGSTLTQQLVK
NFYLTRERHLRRKVQEAIMAVLLEIHYTKSEILETYINEVFLGQSGPRAIHGFALASQHY
FRQPLTELDTEQLALLVGLVKGASYYNPWRNPERAKKRRNLVLTVMHQQGLIDDKELKRA
QAASLGVVEQGDTSMVTYPAFVALVKRQLQEDYQEEDLRSEGLRIFTSLSPMVQRQAEAA
LNQRLRQLEQRHNVKDLQGSMVVTSVGGGEVLALIGDKNPRFEGFNRALDARRPIGSLMK
PFVYLTALEQPDTYHLGTLISDEPVTIKGGDGKLWEPNNVDSVSHGEVPMYMALTHSYNQ
ATARLGMQLGLENVYDTVKAAGFEGRIPGVPSMLLGSVDMSSFEVAGIYHTLAAEGVYTP
LRSIREVLTADGQPLRRYPLELEQRFSLESTFQLQYALQMVLREGTGRSVYNQFPETLPL
AGKTGTTNDQRDSWFAGFSGEHLAVVWLGRDDNSATPLTGSGGALQVWADLMRQLPTQGV
NLQPPEGVSFDWIDAATGMLSAEHCEGAVWLPLRDSQRPEQQSDCRLKEGGRNWWQRLWN
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacgccgttccatttcccgcactaaaaagtctccaccacccagtaaacccccg
cgtcatggttgggcgctgtttcgcctctggttgttttacagtgttattgccatcctggta
ttgcttgctatctggactttgtaccttgatgtggtggtgcgcgcgaaattcgacggtaaa
aagtgggcgctgccggcgcgggtgtattcccgtccgctggagttgtatgaagggctggcg
ctgacgccgccgttgtttgagcaggaattgcaggcattgggttatcgcgcagttggcagc
ctgaatgcgccgggccaatacgtgaagcgcccggtcagtagcgtgcaggccagctaccag
gtgcacagtcgcggttttgatttttgggataagcgtgaagaggcgcggcgtttcggtatc
acgattgcggatggacatgtactgcatttgcgcgatctggccggcgccgatatgccgctg
atgcggctggagccagaagaaattggcggcatttatcccgccgaagccgaagaccgactg
ctggtgcgcttgtccgatttaccgccgttactgggtgaaaccttgctggcggtggaagat
cagcactttctcgatcactacggcgtatcacccctggccatcctgcgggcggctatggtg
aatgtgcgcgaaggcgaagtggtgcagggtggcagcaccctgacccagcaattggtgaag
aatttttacctgacccgcgagcgccatctgcggcgcaaggtgcaggaagccatcatggcg
gtgttgctggagatccactacaccaagtctgaaatcctcgaaacctatatcaacgaagtc
ttccttgggcaaagtggtccgcgtgcgatccacggttttgcactggcgtcgcagcattat
ttccgccagccattgaccgaactggataccgaacagctggcattgcttgtcggtctggtg
aaaggcgcttcctattacaacccctggcgcaatcccgagcgcgctaaaaagcggcgcaat
ctggtattgaccgtcatgcatcagcaggggctgattgatgacaaggaattaaagcgcgca
caagcagcatcgctgggtgtggtggagcaaggcgataccagcatggtgacttacccggcc
tttgtggccttggtgaagcgccagttgcaggaggactatcaggaagaggatctgcgcagc
gaaggtttgcgcatcttcaccagcttgtcgccgatggtgcagcgccaggccgaggcagcg
ctgaatcaacgcctgcgtcagctggagcaacgacacaatgtgaaagacctgcaaggcagc
atggtggtgacctcggtgggcggcggtgaagtgttggcactgatcggcgataaaaatccg
cgtttcgaaggctttaatcgcgccctggatgcgcgtcgtcctatcggctcgttgatgaag
ccattcgtctacctcactgcccttgagcaaccggatacctaccatctcggcacccttatc
agtgatgaaccggtcaccattaaaggcggcgacggcaaattgtgggagcccaacaatgtc
gattcggtcagtcacggcgaggtgcccatgtacatggccttgacccactcctataaccag
gccacggcgcgcctgggcatgcagttaggtttggagaacgtgtacgacaccgtgaaagcg
gcgggttttgaggggcgtatccccggcgttccatccatgttgctcggctctgtggatatg
tcttcgtttgaagtcgcaggcatctaccacacgctggctgcagaaggtgtctacacgcct
ttgcgttcgatccgcgaagtgctgacggccgatggccagccgttgcggcgctacccgctt
gagctggaacaacgtttctcgctcgaaagtaccttccagttgcaatacgccttgcagatg
gtgttgcgcgaaggcaccgggcgcagtgtctacaatcaattcccggagactctgcctttg
gcgggtaagaccggcaccaccaacgatcagcgcgatagctggtttgcgggtttcagcggt
gagcatcttgccgtggtctggctgggccgcgacgataacagtgcaacaccactcaccggt
tcgggtggggcgttgcaggtctgggcggatttgatgcggcaattaccgacgcagggcgtg
aacctgcaaccaccggaaggtgtcagctttgactggattgatgcggcaaccggtatgctc
agtgccgaacattgcgaaggcgccgtctggctgcccctgcgcgatagccagcgtcccgaa
caacaaagcgattgccgcctgaaagaaggtggccgcaactggtggcagcgcctgtggaat
taa

DBGET integrated database retrieval system