KEGG   Cellvibrio sp. PSBB006: CBR65_18415Help
Entry
CBR65_18415       CDS       T04891                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
cell  Cellvibrio sp. PSBB006
Pathway
cell00500  Starch and sucrose metabolism
cell01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cell00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CBR65_18415
Enzymes [BR:cell01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CBR65_18415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ARU29246
UniProt: A0A1Y0G175
LinkDB All DBs
Position
complement(4423487..4425940)
Genome map
AA seq 817 aa AA seqDB search
MNHPTKPRTSFFPAARPALKFLLAGSMTALVACSPSPSEDTDASVAPGAPGKESLWAYSG
KTGIGTSYEQYQEGHYTDSAATGPVSRVWFSLAQGVVTETMFGLIHEAQLREMQFFVSGD
GFVDEEKKDTISHIEYLHTDDAGRPLSLAYKIVNKDKEGKYEIEKHIFTDPDRNSLVMKV
FFRALADNIKPYLYLDPHIANTGSADRAWFDDNTWYAQDGSTALALKTDATVTKSTVGFV
GASDGLDAIKNKTDFIAYQDTGKQSGNVALLLQLPTLSNTNAEWQFVLGFGKDPAESKAS
AQHTLSAGYEHVLANYNGEGAAIGWEDYVQSLPALTQLSSTTTDNGKLLYASALVLKAQE
DKTHAGALIASLSNPWGDTKSAEQSKTGYKAVWPRDFYQVAMAMLALGDKETPKVAFEYL
HKVQVTKTTPGFTGTPGWFLQKTQVDGQLEWIAIQLDQTAMPVMLGWRLWQEGVLSDDEA
TRWYHRMLKPAADFLASGGKVKLDWSDIDLTPPYTQQERWEEQSGYSPSTTAAVIAGLVS
AADLARLADDESSATRYLAAADKYSAMLESTMFTTNGSLQDAPSDGRYYLRITQNTDPND
RAALGTANGQPMPDETDVIDGGFLELVRYGVRPANDPYVLDTLPEIDNMNLPDKLRVKYE
FTFPGVEGTFPGWRRYGIDGYGEDITTGLAYGAVNDQMSDDQRGRVWPFFTGERGHYELA
RAQVEGDIDAASMDTLRNIYVKAMELFANEGLMLPEQVWDGVGNNGGYQYGFGEGTNSAT
PLAWTHAEYIKLLRSFHDQKVWDRYPLVEERYAQPKD
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatccgacaaaaccgcgcaccagtttttttcctgctgctcgtccggcacttaaa
tttttactggccggcagtatgacggcactcgtcgcgtgcagcccttctccttctgaagat
acagacgcaagcgttgcgccaggcgcgccggggaaagagtccctctgggcctactcaggc
aagaccggtatcggaacttcttacgagcaatatcaggagggccattatactgatagcgcc
gctaccggcccggtttcccgcgtgtggttttctcttgctcaaggcgtcgttaccgaaacc
atgttcggtttgattcatgaagcacagttgcgcgagatgcagttctttgtatccggtgac
ggttttgttgacgaagagaaaaaagacaccatcagtcatatcgaatatttgcacaccgat
gacgcgggtcgcccgctgtcgctggcttacaaaattgtcaacaaagacaaagaaggtaag
tacgaaattgaaaaacatattttcactgatccggaccgcaacagcctggtgatgaaagta
tttttccgcgcgctagccgacaacatcaaaccctatctgtatcttgatccgcatattgcc
aataccggcagtgccgatcgcgcctggtttgacgataacacctggtatgcgcaggacggc
agcacagccctggcgttaaagacagatgccaccgttaccaaaagcacggtcggttttgtc
ggcgcttcagatgggcttgatgcaataaaaaataaaaccgattttatcgcttatcaggat
actggcaagcaaagcggtaacgttgcgcttttgctacagttacctacgttaagcaacacc
aatgctgaatggcaattcgtactcggttttggaaaagatccggccgaaagcaaggcaagt
gcacagcacacattgtctgccgggtatgaacacgtgttggcaaattataacggcgaaggt
gctgctattggttgggaagattacgtgcaatccctgccggcattaacgcagctatcatcg
accactaccgacaacggtaaattactttatgccagcgcactggtgttaaaagcacaggaa
gataaaacccatgcaggcgccttgattgcgtcactgtccaatccctggggcgacaccaaa
tccgccgaacaatccaagactggttacaaagccgtttggccgcgcgatttttatcaggtg
gcgatggctatgttggccttgggcgataaagaaacccccaaggttgctttcgaatatctg
cacaaagtacaagtcaccaagacgacacccggttttaccggcacacctggctggttttta
caaaaaacccaagtggacggacaactggaatggattgcgatacaactggatcaaactgct
atgccagtgatgctcggctggcgtttgtggcaggaaggcgtgctcagtgatgatgaagcc
acacgttggtatcaccgcatgctaaaaccggcagccgactttctggcaagcggtggcaaa
gttaaactggattggagtgacattgacttaacaccgccctacacccaacaggaacgctgg
gaagaacaatccggttattcgccctccaccaccgcagccgtgattgccggattggtatcg
gctgctgaccttgcgcgtctggccgatgacgaaagcagtgcaacgcgttatcttgcggcc
gccgataaatattccgctatgctcgaaagcaccatgttcaccaccaacggctcgctgcaa
gatgcacccagcgacggccgttattatttacgcattactcaaaatactgaccccaatgat
cgcgccgctttgggtaccgccaatggccaacccatgcccgacgaaaccgacgttatcgat
ggaggctttctggaattggtgcgctacggtgtgcgtccggcgaatgatccctatgtgctc
gacaccttgcccgaaatcgacaacatgaatctgccggataaactgcgcgtaaaatatgaa
tttacgtttcccggcgtagaaggcaccttccccggctggcgacgttacggcatcgatggt
tatggtgaagacatcaccactggcctggcttacggtgcagtgaatgatcagatgagcgat
gaccaacgcggtcgcgtgtggcccttctttaccggcgaacgcggccattacgaacttgca
cgggcgcaagtcgagggcgatatcgacgctgcaagcatggacaccttgcgcaatatctat
gtcaaagcgatggaattatttgccaacgaagggttaatgttacccgagcaagtctgggat
ggcgtgggcaataatggcggataccaatacggcttcggcgaaggcaccaactccgccacg
ccgctggcctggacccatgcggaatacattaaattattgcgctcctttcacgatcaaaaa
gtgtgggaccgctacccgctggtagaagaacgctacgcacaacctaaggactaa

DBGET integrated database retrieval system