KEGG   Cellvibrio sp. PSBB006: CBR65_18695Help
Entry
CBR65_18695       CDS       T04891                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
cell  Cellvibrio sp. PSBB006
Pathway
cell00061  Fatty acid biosynthesis
cell01100  Metabolic pathways
cell01212  Fatty acid metabolism
Module
cell_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cell00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CBR65_18695
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cell01004]
    CBR65_18695
Enzymes [BR:cell01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CBR65_18695
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     CBR65_18695
Lipid biosynthesis proteins [BR:cell01004]
 Fatty acid synthase
  Component type
   CBR65_18695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ARU29298
UniProt: A0A1Y0G117
LinkDB All DBs
Position
complement(4487738..4488262)
Genome map
AA seq 174 aa AA seqDB search
MIPFEPKSSYSREDLIECGNGRLFGPGNAQLPIPNMLMLDRIVHISQTGGEYGKGEIVAE
LDISPDLWFFDCHFPGDPVMPGCLGLDAMWQLVGFFLAWRGNPGRGRALGCGEVKFTGQI
LPTAKKLSYHINLKRVIERKLIMGIADGRVSVDGKDIYFAYDLRVGLFQNTDNF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgatcccttttgaacctaaaagctcatacagtcgtgaagacctgatcgagtgcggcaac
ggtcgcctgtttggtccgggcaacgcgcaattgcctattccaaatatgttgatgctggac
cgtatcgtgcacatcagccaaaccggtggtgaatacggcaagggcgagattgttgccgaa
ctggatatatcccctgacttatggttcttcgattgccatttccccggtgatcctgtcatg
cccggctgcctcggccttgacgccatgtggcagctagtcggtttcttcctcgcctggcgc
ggcaaccccggccgcggtcgcgcactgggttgtggtgaggtgaagttcaccggtcagatc
ctgcctaccgctaaaaaactcagctatcacatcaatctcaagcgtgttatcgaacgcaag
ctgatcatgggcattgccgatggtcgcgtatccgtagatggaaaagacatttacttcgct
tacgatctacgcgtcggcttgttccagaacaccgacaacttctaa

DBGET integrated database retrieval system