KEGG   Cedecea neteri: LH23_02430Help
Entry
LH23_02430        CDS       T03328                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cem  Cedecea neteri
Brite
Enzymes [BR:cem01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LH23_02430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AIR59548
LinkDB All DBs
Position
524066..524557
Genome map
AA seq 163 aa AA seqDB search
MTALACTGLTQAATVAMNTVDANGTSTPAGTIEYHATQYGVVFTPNLKGLPPGIHGFHVH
TNPNCGPAMQDGKMVAGLAAGGHLDPAHTGKHEGPWGNGHLGDLPALYVDSDGTATYPVL
APRLRMSDLKGHSLMIHAGGDNHSDHPAMLGGGGARMVCGVTS
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
attaccgccctcgcctgcaccgggctgacgcaggccgccactgtcgccatgaataccgtg
gacgccaacggtacctccaccccggcgggcaccattgaataccacgccacccagtacggc
gtggtctttacgccaaacctgaaaggcctgccgccggggattcacggcttccacgttcac
actaatccgaactgcggccccgccatgcaggacggcaaaatggtggctggcctggcggct
ggcggccacttagatccggcccacaccggcaagcatgaaggcccgtggggcaacggccac
ttgggcgacctgcctgcgctgtacgtcgacagcgacggcaccgcgacctacccggtgctg
gctcctcgcctgcgcatgtctgacctaaaaggccactcgctgatgatccacgccggtggt
gacaaccattctgaccacccggcaatgctcggcggcggcggcgcgcgtatggtttgtgga
gtgacgtcatga

DBGET integrated database retrieval system