KEGG   Cedecea neteri M006: LH23_04250Help
Entry
LH23_04250        CDS       T03328                                 

Definition
(GenBank) decarboxylase
Organism
cem  Cedecea neteri M006
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoRC HTH_DeoR HTH_11 TrmB HTH_23 HTH_Tnp_1 HTH_Mga HTH_Tnp_ISL3 GntR HTH_12 MarR_2 MerR Put_DNA-bind_N FaeA DUF2089 Fe_dep_repress HTH_Crp_2 HTH_AsnC-type HTH_36
Motif
Other DBs
NCBI-ProteinID: AIR59891
LinkDB All DBs
Position
complement(879548..880312)
Genome map
AA seq 254 aa AA seqDB search
MTDYDALPEQRQAMIHQILTETGRVIGADVARKLGVSEHTIRRDLQELARRGLCKKVYGG
AISQFQQSASFETRVAQDVVEKSQVARKCAGMIKANTCVFLDAGSTYLAMVEFIPEELDL
TIVTNSPQIAAALSGRTRGELILLGGKVNPLTGSTLGSDTVNQLRGMVFDQTFIGVCGLD
PQAGLSAVYYEDACFKREVLSQSNEVIAAVTANKMSQVARYKVAPCEDIDIAVVSAETKI
ADFGGVNLRIEIAG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgacagattatgacgcattgcctgaacagcgccaggcgatgatccaccagatcctgacc
gaaacgggcagggtgatcggggccgatgtggcgcggaagctgggcgtgtccgagcacact
atccgccgggatctgcaggagttggcgcgtcgaggcctgtgcaaaaaggtctacggcggt
gccatcagccagtttcagcagtctgccagctttgaaacccgcgtggcacaggatgtggtt
gagaagtcccaggtggcgcggaagtgcgccgggatgatcaaagccaatacctgcgtgttt
ctcgacgctggttcaacctatctggcgatggtggaatttattcctgaagagctggatctc
accattgtcaccaattccccgcagattgctgcggcgctgagcgggcgcacgcggggcgaa
ctgattctgttgggcggtaaagtgaacccgctgaccggcagcacgctgggttccgacacg
gtcaatcagctgcgcggcatggttttcgaccagacctttatcggcgtgtgcgggctggat
ccgcaggctggcttaagtgcggtttattacgaagatgcctgttttaagcgggaagtgctg
agccagagcaacgaggtgatcgccgccgtgacggccaacaagatgtcccaggtggcgcgc
tataaagtggcgccctgcgaagatatagatattgcggtggtcagcgccgaaaccaaaatt
gccgatttcggcggcgttaacctgcggattgaaatcgcgggctag

DBGET integrated database retrieval system