KEGG   Cedecea neteri: LH23_05825Help
Entry
LH23_05825        CDS       T03328                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cem  Cedecea neteri
Pathway
cem00620  Pyruvate metabolism
cem00680  Methane metabolism
cem01100  Metabolic pathways
cem01120  Microbial metabolism in diverse environments
cem01200  Carbon metabolism
Module
cem_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LH23_05825
  09102 Energy metabolism
   00680 Methane metabolism
    LH23_05825
Enzymes [BR:cem01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LH23_05825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIR60198
LinkDB All DBs
Position
complement(1224608..1227259)
Genome map
AA seq 883 aa AA seqDB search
MNERYSALRSNVSMLGKLLGDTIKDALGENILDRVETIRKLSKSSRAGNEANRQELLSTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISATGEAASNPEVIAKTLQKLKNQPGIGEA
DIRAAVESLSLELVLTAHPTEITRRTLIHKLVEVNSCLKQLDHSDLADYERNQIMRRLRQ
LVAQAWHTDEIRKHRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEENLNYKLPVDF
VPVRFTSWMGGDRDGNPNVTSDITRHVLLLSRWKATDLFLRDIAVLVSELSMVECTAELS
ELAGPDAGQEPYRHIMKGLRQQLLSTQAWLEARLKGQRLPKPEGLLIQNEQLWDPLYACY
QSLQACGMGIIANGQLLDTLRRVKCFGVPLVRIDIRQESTRHSEALGEMTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRQWEPSADTQEVLETCKVVAEAPRGSIAAYVISMAKTP
SDVLAVHLLLKEAGCTFALPVAPLFETLDDLNNADDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYEAQDALIKTCEKAGIALTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEITISSLSLYTSAILEANLLPPPEPKKEWIQIMNSL
SATSCEMYRGYIRENKDFVPYFRSATPELELGKLPLGSRPAKRRPNGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVEEGKQSELETMCRDWPFFSTRLGMLEMVFAKADLWLAE
YYDQRLVKPELWKLGKQLRDQLEADIKVVLDIANDSHLMEDLPWIAESITLRNIYTDPLN
VLQAELLHRSRQSEEKGEAPDARVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacgctattctgctttgcgaagtaatgtcagcatgctcggaaaactgctcgga
gataccatcaaagatgcgctgggggaaaatattctcgaccgcgtagaaacgatccgtaag
ttatccaagtcctcccgcgcaggtaatgaagccaatcgtcaggagctgctgagcacgctg
cagaacctttcaaatgatgaactgctccccgtcgcccgcgcctttagccagtttcttaat
cttgccaacaccgctgagcagtaccacagcatctccgcgacgggcgaagcggccagcaac
ccggaagttatcgctaaaacgctgcaaaaactaaaaaaccagccgggcattggcgaagcg
gacattcgcgcagccgttgagtctctctctctggagctggtgctcacagctcaccccact
gagatcacccgccgcaccctgattcacaaactggtcgaagtaaacagctgccttaagcag
ctcgaccacagcgatctcgccgactacgagcgcaaccaaatcatgcgccgcctgcgccag
ctggttgctcaggcatggcataccgacgaaattcgtaagcatcgcccttctccggtcgac
gaagccaaatggggctttgcggtggtagaaaacagcctctgggaaggggtgccaaactac
ctgcgtgagcttaacgaacagctcgaagagaatctgaattacaagctgccggtggatttc
gttccggtacgctttacctcctggatgggcggcgaccgcgacggtaacccgaacgtaacg
tccgacatcacccgtcacgtcctgttgctcagccgctggaaagccactgacctgttcctg
cgcgatatcgcggtgctggtttccgagctgtcgatggtggaatgcacggctgagcttagc
gaactggcagggccggatgctggacaggaaccttaccgccacatcatgaaaggcctgcgc
cagcagctgctctccacccaggcctggcttgaagcccgactgaaaggccagcgcctgccg
aagccggaaggcctgctcattcaaaacgagcagctttgggatccgctctacgcctgttat
caatccttgcaggcctgcggcatgggcatcattgctaacgggcagttgctggacaccctg
cgccgcgtgaaatgcttcggcgtgccgctggtacgtattgatattcgtcaggaaagcacc
cgccacagcgaagcgctgggcgaaatgacccgctatcttggcatcggcgactacgagagc
tggtcagaggccgataaacaagccttcctgatccgcgaactgaactccaagcgccctctg
ttgcctcgtcagtgggagccaagcgctgacactcaggaagtgctggaaacctgcaaagtg
gtggccgaagcgccacgcggttccattgctgcctacgttatttcgatggcaaaaacaccg
tccgacgtgctggccgttcacctgctgctgaaagaagcgggctgtaccttcgccctgccg
gttgcgccgctgttcgaaaccctcgacgacctgaataacgccgacgatgtcatgacccag
ttgctgaacatcgactggtaccgtggctttatccagggcaaacagatggtgatgattggc
tattccgactcggcgaaagacgcaggcgtaatggctgcatcctgggcgcagtacgaagca
caagatgcgctgatcaaaacctgcgagaaagcaggtatcgccctgacgttattccacggg
cgcggcggctccatcggccgcggcggtgcgccagcccacgcagccctgctttctcagccg
ccgggaagcctgaaaggcggcctgcgcgtcaccgagcaaggcgagatgattcgctttaaa
tacggcctgccggaaatcaccatcagcagcctgtctctctacaccagcgcgattcttgaa
gctaaccttctgccgccgccggagccgaagaaagagtggattcagatcatgaactcactt
tccgcgacatcgtgcgagatgtatcgcggctatattcgcgagaacaaagacttcgtgccg
tatttccgttccgccacgccggagctggaactgggcaaactaccgttgggctctcgccca
gccaaacgtcgtccaaacggcggggtagaatctttacgtgcgattccgtggatcttcgcc
tggacccaaaaccgcctgatgctgccagcctggctgggcgcaggtgcggcgctgcagaaa
gtcgtggaagaaggcaagcaaagcgagctggaaacaatgtgccgcgactggccgtttttc
tctactcgcctcggcatgctggagatggtgtttgccaaagccgacctttggctggcggaa
tactatgatcagcgcctggtgaagcctgagctgtggaagctgggtaaacagctgcgtgac
cagctggaagccgacatcaaagtcgtgctggatatcgccaacgactcgcacctgatggaa
gatttaccgtggattgccgagtccattaccctacgtaatatctataccgatccactgaac
gtcctgcaggccgaactgctgcaccgttcacgccagtcggaagaaaaaggcgaagcgcct
gatgcccgagtagagcaagccttgatggtcaccatcgccggggttgccgccgggatgcgt
aataccggctaa

DBGET integrated database retrieval system