KEGG   Cedecea neteri M006: LH23_11375Help
Entry
LH23_11375        CDS       T03328                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
cem  Cedecea neteri M006
Pathway
cem00550  Peptidoglycan biosynthesis
cem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cem00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LH23_11375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cem01002]
    LH23_11375
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cem01011]
    LH23_11375
Enzymes [BR:cem01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LH23_11375
Peptidases and inhibitors [BR:cem01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   LH23_11375
Peptidoglycan biosynthesis and degradation proteins [BR:cem01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   LH23_11375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AIR61241
LinkDB All DBs
Position
complement(2395044..2396255)
Genome map
AA seq 403 aa AA seqDB search
MNTAPSARFVKRLALTSAFALAAMASAQADDLNIKTMIPGVPQIDAEAYILIDYNSGKVL
AESNADARRDPASLTKMMTSYVIGQAMKAGKFDDNAMVTIGKDAWATGNPVFKGSSLMFL
QPGMQVPVNKLVRGINLQSGNDACVAMADFVAGSQDAFVSLMNGYVSALGLKNTHFQTVH
GLDAEGQYSSARDMALIGQALIRDVPNEYAIYKEKEFTFNNIRQTNRNGLLWDTSLNVDG
IKTGHTDAAGYNLVASATEGQMRLISAVLGGHTYKGRETESKKLLTWGFRFFETVSPLKA
GKEFASEPAWFGDNDRASLGVDKDVYLTIPRGRMKDLKASYVLTTTELHAPLQKNQVVGT
INFQLDGKTIEQRPLVVLQEMPEGNFFSRIIDYIKLMFHHWFG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagctccttctgcacgttttgttaagcgcctggcgctcacctcggctttcgct
cttgcggctatggcctctgctcaagctgacgacctcaacattaaaactatgatcccgggc
gtcccgcagattgatgcagaagcgtatatcctgattgactacaactcaggcaaagtgctg
gccgaatcaaacgccgacgcacgtcgcgacccggccagcctgaccaaaatgatgaccagc
tacgtcattggccaggcgatgaaagccggcaagttcgacgacaatgcaatggtcaccatc
ggcaaagatgcctgggccaccggtaacccggtgtttaaaggctcctcgctgatgttcctg
cagcctggtatgcaggtgccggtcaacaaactggttcgcggtatcaacctgcagtcaggt
aacgatgcctgtgtggcgatggccgacttcgttgccggtagccaggatgccttcgtgagc
ctgatgaacggctacgtttccgctctgggcctgaaaaacacccacttccagaccgtgcac
ggcctggatgccgaaggtcagtacagctctgcgcgtgatatggcgctgatcggccaggca
ctgatccgcgatgtaccgaacgaatacgctatctacaaagaaaaagagttcaccttcaac
aacattcgtcagactaaccgcaatggtctgctgtgggataccagcctcaacgttgatggt
attaaaaccggccacacggatgcagcaggctataacctcgtagcttccgcaaccgaaggc
cagatgcgcctgatctccgctgttcttggcgggcacacctacaaaggccgtgaaacagaa
agcaaaaagctgttgacctggggcttccgcttctttgaaactgtttctccgctgaaagcc
ggcaaagagtttgcttctgagccagcctggtttggcgacaacgatcgtgcctccctcggc
gtggataaagacgtttatctgaccattcctcgtggccgcatgaaggatctgaaagccagc
tacgtgctgaccacgactgaactgcacgcgccgctgcagaaaaaccaggttgtcggtacc
attaacttccagttggatggcaaaaccatcgagcagcgtccgttagtcgtgctgcaggaa
atgccggaagggaatttcttcagccgaatcattgattacatcaaactgatgttccaccac
tggttcggttaa

DBGET integrated database retrieval system