KEGG   Cedecea neteri M006: LH23_15950
Entry
LH23_15950        CDS       T03328                                 

Definition
(GenBank) EvpB family type VI secretion protein
  KO
K11900  type VI secretion system protein ImpC
Organism
cem  Cedecea neteri M006
Brite
KEGG Orthology (KO) [BR:cem00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cem02044]
    LH23_15950
Secretion system [BR:cem02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   LH23_15950
SSDB
Motif
Pfam: VipB VipB_2 APG6 PaaA_PaaC
Other DBs
NCBI-ProteinID: AIR62092
LinkDB
Position
3340118..3341653
AA seq 511 aa
MLMSVKNENTASAESVVLDQPVYASLFEKINLNPVSAISALDVWQDNQAMSDATADERLT
AGMQVFLECLSKAGSKVEKLDKALIDHHIAELDFQISRQLDAVMHHDEFQAVESLWRGVK
SLVDKTDFRQNVKIELLDLSKDDLRQDFEDAPEIIQSGLYLQTYVAEYDTPGGEPIAALV
SAYEFDASAQDVALLRNISKVSAAAHMPFIGSAGPKFFLKESMEDVAAIKDIGNYFDRAE
YIKWKSFRDTDDSRYIGLVMPRVLGRLPYGPDTVPVRSFNYVEEVKGPDHDKYLWTNASF
AFAANMVRSFIQNGWCVQIRGPQAGGAVKDLPIHLYDLGTGNQVKIPSEVMIPETREFEF
ANLGFIPLSYYKNRDYACFFSANSTQKPALYDTADATANSRINARLPYIFLLSRIAHYLK
LIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDAKVVVEDIEDNPGF
FRVKLYAVPHFQVEGMDVNLSLVSQMPKAKA
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgctgatgtctgtaaaaaatgagaatactgctagcgcagaaagtgtcgtacttgaccag
cctgtttatgcttctctgtttgaaaaaatcaaccttaatccggtgtccgccataagcgca
ctggatgtctggcaggacaatcaggcaatgtccgacgctaccgccgatgagcgactgact
gcggggatgcaggtgtttcttgagtgcctgagtaaggcgggctcaaaggttgagaaactc
gacaaagcgctgatcgatcaccacattgccgagctggatttccaaatcagccgtcaactg
gatgcagtcatgcatcacgatgagtttcaggccgtggaatccctgtggcgaggggttaaa
tcgctggtggataaaactgatttccgccagaacgtcaaaattgagctgcttgatctctcc
aaagacgacctgcgacaggattttgaggatgccccggaaattatccagagcgggctgtac
ctgcaaacctatgtggcagagtacgacacgcctgggggggagccgatagctgccctcgtc
tcggcctatgagttcgatgcatccgctcaggatgtggcgcttttacgtaatatttccaaa
gtttctgcggcagcacacatgccgtttatcggctctgccgggccaaagttcttcctgaaa
gaatcaatggaagacgtggccgccatcaaagatattggcaactacttcgaccgcgccgaa
tacatcaagtggaagtcattcagggacactgatgacagccgttatattggcctggttatg
cctcgagtgcttggccgcttgccttatgggcccgataccgtgccggtacgcagcttcaac
tatgtggaagaagtaaaaggtccggaccacgataaatacttgtggactaatgcatctttt
gcttttgccgccaacatggtgcgcagctttatccagaatggctggtgcgtccaaattcgc
ggcccgcaggctgggggagcagtaaaagatctgccgattcatttgtacgatcttggtacc
ggcaatcaggtaaaaattccgtcggaagtcatgatcccggaaacccgggaatttgagttc
gctaatctcggtttcatcccgctgtcttattataaaaatcgcgattacgcgtgcttcttc
tcggcaaactccacgcagaaaccggccctgtatgacaccgcagatgccacggctaacagt
cgtatcaatgcgcggttaccctacattttcctgctttctcgtattgcgcactacctgaag
cttattcagcgtgaaaacatcggcactaccaaggaccgccgtctgctggagctggagctg
aacacctgggttcgcagtctggtcaccgaaatgaccgatccaggcgacgaactgcaggct
tcccacccgctgcgcgatgccaaagtggtggtggaagatatcgaggataacccgggtttc
ttccgcgtgaagctttatgccgtgccacatttccaggtcgaaggtatggacgtcaatctg
tcactggtttcccagatgccgaaggcgaaagcgtaa

DBGET integrated database retrieval system