KEGG   Cedecea neteri: LH86_04005Help
Entry
LH86_04005        CDS       T03337                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
cen  Cedecea neteri
Pathway
cen00250  Alanine, aspartate and glutamate metabolism
cen00410  beta-Alanine metabolism
cen00640  Propanoate metabolism
cen00650  Butanoate metabolism
cen01100  Metabolic pathways
cen01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LH86_04005
   00650 Butanoate metabolism
    LH86_04005
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LH86_04005
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LH86_04005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cen01007]
    LH86_04005
Enzymes [BR:cen01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LH86_04005
Amino acid related enzymes [BR:cen01007]
 Aminotransferase (transaminase)
  Class III
   LH86_04005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AIR64272
LinkDB All DBs
Position
complement(823164..824429)
Genome map
AA seq 421 aa AA seqDB search
MKSAELNQRRLQATPRGVGVMCSYFAEKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
VIAAVEKQLQAFTHTAYQIVPYESYVSLAERINELAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTKRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHAVYPNAAHGVTTD
DALKSLDRIFKADIAADQVAAIILEPVQGEGGFNVAPPEFMQALRQLCDTHGILLIADEV
QTGFARTGKLFAMDYYDVKADLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIKEEQLCKRATQLGEHLKEVLNQARQSCPAIVDVRGQGSMVAVEFND
PQTGKPSPEFTREVQLKAQEQGLLLLSCGVYGNVIRFLYPLTIPDAQFTKALAILSRVLK
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagtgcagagctgaatcagcgtcgtttacaggccacgccgcgcggcgtgggcgtg
atgtgtagctatttcgcagagaaggcggagaacgccaccctgtgggatgtggaaggcaac
gaggttatcgattttgccgccgggattgccgtgctgaacaccggccatcgtcacccgaaa
gtgattgccgcggtagaaaaacaattgcaggcctttacccacacggcttaccagattgtc
ccttatgaaagctatgtttcgctggctgagcgtattaacgaactggcgccgattgacggc
ccggcgaaaactgcgttcttcaccaccggtgcagaagcggttgagaatgcggtgaaaatc
gcccgcgcttataccaaacgccccggcctgatcaccttcggcggcggcttccatggccgt
acctttatgaccatggcgctgaccggcaaagtggcaccgtacaaaatcggttttggtccg
ttccctggctccgtctaccacgcggtttacccgaatgccgctcacggtgtgacgactgac
gatgcgctgaaaagcctggatcgtatctttaaagccgatatcgccgcggaccaggttgcg
gccatcatactcgagccggttcagggggaaggcggcttcaacgtggcgccacctgaattt
atgcaggcgctgcgccagctgtgcgacacccacggcattctgctgattgctgatgaagtg
cagaccggcttcgcgcgtaccggcaagctgtttgcgatggactattacgacgtcaaagcc
gacctgatgacgatggcgaaaagcctggccggtggcttcccgctgtccggcgttgtgggc
cgtgccgaagtgatggatgcccctgcgcctggcggtctgggtggcacctatgcgggcaac
ccgctggcggttgcggcagctcatgcggtgctggatgtgatcaaagaagaacaactgtgc
aagcgtgctacccagcttggcgaacacctgaaagaagtgctgaatcaggcacgtcaaagc
tgcccggcgattgttgacgtacgtggacagggctcgatggtcgcagtggagtttaacgat
ccgcagaccgggaaaccttcgccagaatttacccgcgaagttcagctgaaagctcaggaa
caagggctgttgctgctgagctgcggcgtctacggcaacgttattcgcttcctttatccg
ctgaccattcctgatgctcagttcaccaaagcgctggccattctgtccagagtgcttaag
ggctaa

DBGET integrated database retrieval system