KEGG   Cedecea neteri ND14a: LH86_08970Help
Entry
LH86_08970        CDS       T03337                                 

Definition
(GenBank) cell division protein FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
cen  Cedecea neteri ND14a
Pathway
cen00550  Peptidoglycan biosynthesis
cen01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cen00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LH86_08970
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    LH86_08970
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cen01011]
    LH86_08970
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cen03036]
    LH86_08970
Enzymes [BR:cen01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LH86_08970
Peptidoglycan biosynthesis and degradation proteins [BR:cen01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   LH86_08970
Chromosome and associated proteins [BR:cen03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    LH86_08970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF1616
Motif
Other DBs
NCBI-ProteinID: AIR65212
LinkDB All DBs
Position
1873896..1875662
Genome map
AA seq 588 aa AA seqDB search
MRAAAKTLKPKRQEEQANFVSWRFALLCGCILLALAFLLGRVAWLQIINPDMLVRQGDMR
SLRVQEVSTSRGMISDRAGRPLAVSVPVNAVWADPKELHDAGGVTLDNRWKALADALKIP
LDQLSSRVNSNPNGRFIYLARQVNPDIGDYIKKLKLPGIHLRQESRRYYPSGEVTAHLIG
FTNVDSEGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDISSTDSQAAHNLALSIDERL
QALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNLTGTAKDVMRNRTIT
DVFEPGSTVKPMVVMTALQRGVVNENTVLNTIPYRINGHEIKDVARYSELTLTGVLQKSS
NVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSGLYPQKQRWSDIERATFSFGYG
LMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERIFAESTVRTVVHMMESVALPGGG
GVKAAIKGYRIAIKTGTAKKVGPDGKYINKYIAYTAGVAPASQPRFALVVVINDPQGGKY
YGGAVSAPVFGAIMGGVLRTMNIEPDALATGEKSEFVINQKEASGGRS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagcggcaaaaacgcttaaaccaaaacgtcaggaagaacaggccaactttgtg
agttggcgttttgcgttgctctgcggttgcattctgttggcgctggctttccttctgggc
cgtgtcgcctggctgcaaatcattaatccggacatgctggtacgtcagggtgacatgcgt
tcactgcgcgtacaggaggtctctacctcccgcggcatgataagcgatcgcgcgggacgc
cctcttgcagttagcgtgccggtaaatgccgtttgggctgacccgaaagaattgcatgat
gctggcggagtgacgctggataaccgctggaaggcgctggcagatgcactaaaaattcct
ctcgaccagctttcatctcgcgtgaacagtaatcccaatgggcggtttatttatctcgcg
cgtcaggttaacccggatattggcgattacatcaaaaagcttaagcttccgggaattcac
ctgcggcaggagtctcgtcgctactatccatccggcgaagtgaccgctcacctcatcggc
ttcaccaacgtggacagcgaagggatcgagggggtggaaaaaagctttgataaatggctc
accggtcagcctggcgagcgcattgtgcgtaaagatcgctacgggcgcgttatcgaagac
atttcctctaccgacagccaggccgcccataacctggctttgagcattgatgaacgcctg
caggcgctggtttaccgtgaactgaataacgccgttgccttcaacaaagccgaatcgggc
agcgctgttttggttgatgtgaacactggtgaagtcctggcgatggcgaacagcccgtcc
tacaacccgaataatctgaccggcacggcaaaagacgtaatgcgtaaccgtaccatcacc
gacgtcttcgaaccgggttccaccgttaagccaatggtggtgatgaccgcgctgcagcgg
ggtgtggtgaatgaaaataccgtactgaatacgattccgtaccgcattaatggtcatgag
atcaaagatgtggcgcggtacagcgaattgacccttaccggggtattacagaagtcgagt
aacgtcggtgtttctaagctggcgttagcgatgccctcctcagcgttggtagatacttac
tcacgttttggactgggaaaagcgaccaatttggggttggtcggggaacgcagtggctta
tatcctcaaaaacaacggtggtctgacatagagagggccaccttctctttcggctatggg
ctaatggtaaccccgttacagttagcgcgagtctacgcaacgatcggcagctacggcatt
tatcggccgctgtcgataaccaaagttgacccgccggttcccggcgagcgtatctttgct
gaatcaaccgtccgcaccgtggtgcacatgatggaaagcgtggcgctgcccggcggcggc
ggcgtgaaggcggccattaagggctaccgtattgcgattaaaaccggtactgcgaaaaaa
gtcgggccggacggtaagtacatcaacaaatacattgcttacaccgcaggcgttgcgcca
gccagccagccgcgatttgcgctggtggtggttatcaatgacccgcagggcggtaagtat
tacggcggtgccgtatctgcacctgtgttcggtgccatcatgggcggcgtactgcgcacc
atgaacatcgagccggatgcgctggcaaccggtgagaaaagcgaatttgtaattaatcag
aaagaggcatcaggtggcagatcgtaa

DBGET integrated database retrieval system