KEGG   Cedecea neteri: LH86_10035Help
Entry
LH86_10035        CDS       T03337                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cen  Cedecea neteri
Pathway
cen00473  D-Alanine metabolism
cen00550  Peptidoglycan biosynthesis
cen01100  Metabolic pathways
cen01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cen00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LH86_10035
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LH86_10035
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    LH86_10035
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cen01011]
    LH86_10035
Enzymes [BR:cen01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LH86_10035
Peptidoglycan biosynthesis and degradation proteins [BR:cen01011]
 Precursor biosynthesis
  Amino acid ligase
   LH86_10035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_3 ATP-grasp_4 RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: AIR65412
LinkDB All DBs
Position
complement(2107790..2108890)
Genome map
AA seq 366 aa AA seqDB search
MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKSKFDVVLLGIDKQGQWHINDASSYLLN
ANNPALIALNRSEKNVALVPGQTEHQLIETSTAEQLSQIDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSGVLGSAVSMDKDVAKRLLRDAGLNVAPFITLTRANRAKISFAEIEKQLGL
PLFVKPANQGSSVGVSKASTEEQYHAAVALAFEFDHKVVVETGIKGREIECAVLGNDYPQ
ASTCGEIVVNSEFYSYDTKYIDEQAAQVVVPAALDADVNDKIRKIAVRAYQALECSGMAR
VDVFLTENNDVIINEINTLPGFTNISMYPKLWQASGISYQELITRLIELALERHQQDCAL
KSSITS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactgcgggttggtatcgtgtttggtggaaaatcggcagaacacgaggtgtcg
ctgcagtcggcaaaaaatatcgtcgacgccattgataagtcgaagtttgatgttgtgctg
ctggggattgataaacagggccagtggcatatcaacgatgcgtccagctacctgctgaac
gccaataatccggcgcttatcgccctgaaccgatcagagaaaaacgtggcgctggtcccc
ggccagaccgaacaccagctgattgaaaccagcaccgcagagcagctttcccaaatcgac
gtgattttcccgattgtgcacggcacgctgggcgaggacggttccctgcagggcatgctc
cgcgtcgccaatctgccgtttgtcggctccggcgtgctgggctcagcggtcagcatggac
aaagacgtcgccaaacgcctgctgcgcgatgcgggcctgaacgttgcccctttcatcacg
ctgacccgcgctaaccgcgccaaaatcagcttcgccgagatcgaaaaacagctgggtctg
ccgctgtttgtgaagccagccaaccagggttcctctgtcggcgtcagcaaagccagcacc
gaagagcagtaccacgcggcggtggcgttagcctttgagtttgaccataaagtggtggtt
gaaaccggcattaaaggccgtgaaattgagtgcgccgtgctggggaatgattacccgcag
gccagcacctgcggcgagatcgtggtgaacagcgagttctattcttacgacaccaagtac
attgatgagcaagcggcacaggtcgttgtcccggcggcgctcgacgccgacgttaacgac
aaaatccgtaaaatcgccgtgcgtgcctatcaggcgctggagtgcagcggtatggcccgc
gttgacgtgttcctgacggaaaataacgacgtgatcatcaatgagatcaacacgctgccg
ggctttaccaacatcagcatgtatcccaagctgtggcaggccagcggcatcagctaccag
gagttgattacccgcctgatcgagctggcccttgagcgccaccagcaggactgcgcgctg
aaaagctcaatcacttcgtaa

DBGET integrated database retrieval system