KEGG   Cedecea neteri: LH86_11450Help
Entry
LH86_11450        CDS       T03337                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cen  Cedecea neteri
Pathway
cen00010  Glycolysis / Gluconeogenesis
cen00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LH86_11450
   00500 Starch and sucrose metabolism
    LH86_11450
Enzymes [BR:cen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LH86_11450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase DUF4038
Motif
Other DBs
NCBI-ProteinID: AIR65674
LinkDB All DBs
Position
2394747..2396141
Genome map
AA seq 464 aa AA seqDB search
MTAFPKTFLWGGAIAANQVEGAWQEGGKGISTSDVMQQGVFGPLKERVPGDSGIKDIAID
FYHRYPQDIALFAEMGFSCLRMSIAWTRIFPQGDESEPNEAGLAYYDKLFDELAQHGIQP
MVTLSHYEMPWGLVKQYGGWGNRKVIDCFERYARCVFTRYQHKVKLWLTFNEINMSLHAP
LTGVGLEGEPNKGEIYQAIHHQLVASSLAVKACHEIIPDAKIGNMLLGGLMYPLTCKPED
VLETLQENRSWLFFGDAQCRGSYPGYMQRYFRDNGIQLEISENDREILKNTVDFISFSYY
MTGCVTADAELNAKSRSNILSMVPNPHLPASEWGWQIDPTGMRILLNMLWDRYQKPLFIV
ENGLGAKDKPEDDGTINDDYRISYLSDHLVQVSEAIEDGVDVMGYTSWGPIDLVSASKAE
LSKRYGFIYVDRDDQGNGTLARSRKKSFHWYKEVITTNGGSLKR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgacagcatttccgaagacatttctgtggggcggggctattgccgcaaaccaggttgaa
ggcgcgtggcaggagggcggcaagggcatttctacctcggacgtcatgcagcagggggtg
tttggcccactgaaggagcgcgtgccgggagacagcggcattaaagatatcgccatcgat
ttttaccaccgctacccgcaggacattgcgctgtttgctgaaatggggtttagctgcctg
cgcatgtccatcgcctggacgcgcattttcccgcaaggcgacgagtctgagccaaacgaa
gccgggctggcgtattacgacaaactgtttgatgagctggcacagcacggtattcagccg
atggtgaccctctctcactacgaaatgccgtgggggctggtcaagcaatacggcggctgg
ggcaatcgcaaagttattgactgctttgagcgttacgcccgctgcgttttcacccgctat
cagcataaagtgaagctatggctgacgttcaatgaaattaacatgtcgcttcatgcgccg
ctgaccggcgtcgggctggaaggggagccgaacaaaggcgaaatttatcaggctatccat
catcagctggttgccagcagcctggcggtgaaagcctgccacgaaatcatcccggatgcg
aaaatcggcaatatgctgctgggcggcctgatgtacccgctcacctgtaaaccggaagac
gtgctggaaacgctgcaggaaaaccgcagctggttgttctttggcgacgcgcaatgtcgg
ggcagctatccgggttatatgcagcgttatttccgtgacaatggcattcagcttgaaatc
agcgagaacgatcgtgaaattctgaaaaataccgtcgattttatctcattcagctattac
atgaccggctgcgtgacggcagatgcagagcttaacgcgaaatcccgcagtaatattctc
agcatggtgccaaacccgcatttgccagcgtccgaatggggctggcagattgacccgact
ggcatgcgcatcctgctcaatatgctgtgggatcgctaccagaaaccgctgtttattgtc
gaaaacggcctgggggcgaaagataagcccgaagatgacggcacgatcaacgacgattac
cgcatcagctacctgagcgaccatctggtacaggtgagcgaggcgatcgaggacggcgta
gacgtgatgggctacaccagctgggggccaatcgatctggttagtgcgtcgaaagccgaa
ctgtcgaagcgctacgggtttatctacgttgatcgcgatgaccaggggaacggcacgctt
gcacgttcaagaaagaaaagcttccactggtataaagaggtgattaccaccaacggtggc
agcctgaagcgctaa

DBGET integrated database retrieval system