KEGG   Cedecea neteri ND14a: LH86_14225Help
Entry
LH86_14225        CDS       T03337                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cen  Cedecea neteri ND14a
Pathway
cen00480  Glutathione metabolism
cen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cen00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LH86_14225
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cen02000]
    LH86_14225
Enzymes [BR:cen01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LH86_14225
Transporters [BR:cen02000]
 Other transporters
  Pores ion channels [TC:1]
   LH86_14225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: AIR66204
LinkDB All DBs
Position
complement(2966504..2967106)
Genome map
AA seq 200 aa AA seqDB search
MKLYFKPGACSLSPHIILRESGLDFSLVKVDLANKRTENGDDFLAINPKGQVPALVLDDG
SLLTEGVAIVQYLADKVPDRHLLAPAGSMTRYHTLEWLNYVATELHKGFSPLFNPATPEE
FKAVVRKQMEKKFHYVNESLQDKQWLMGARFTVVDAYLFTVLRWAYGLKLDLAGLSNIEA
YVERMKARPAVSAALTAEGI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtatttcaagcccggtgcctgttccctctccccacacattatcctgcgtgaa
tctggcctggacttttcgctggtgaaagttgacctcgcgaacaaacgcaccgaaaacggt
gacgattttctcgccattaaccctaaaggacaggtgcccgcgctggtgctggatgacggc
tctctgctgaccgagggcgtggctatcgtgcaatacctggcggataaagtgcctgaccgc
catctgctggccccggcgggcagcatgactcgctaccacacgctggagtggctgaattat
gtggcaaccgagctgcataaaggtttttccccgctgttcaacccggcgacgcccgaagag
ttcaaggccgtggttcgcaagcagatggagaaaaaattccactatgtgaacgaatcgctg
caggacaaacagtggctgatgggcgcccgcttcaccgtggtggatgcctacctgtttacc
gtgctgcgctgggcctatggcctgaagctggacctggcggggctgtcaaatatcgaagcc
tacgttgagcgcatgaaggcgcgtccggcggtgtctgcggcgctgaccgccgaagggatt
taa

DBGET integrated database retrieval system