KEGG   Cedecea neteri ND14a: LH86_19620Help
Entry
LH86_19620        CDS       T03337                                 

Definition
(GenBank) peptidase M15
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
cen  Cedecea neteri ND14a
Pathway
cen00550  Peptidoglycan biosynthesis
cen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cen00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LH86_19620
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cen01002]
    LH86_19620
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cen01011]
    LH86_19620
Enzymes [BR:cen01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LH86_19620
Peptidases [BR:cen01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   LH86_19620
Peptidoglycan biosynthesis and degradation proteins [BR:cen01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   LH86_19620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AIR67210
LinkDB All DBs
Position
complement(4136023..4137228)
Genome map
AA seq 401 aa AA seqDB search
MTILQMPATLRGLVAGTTLLLIAAPALSAEQTADAPQVDAKAWILMDYASGKVLAEGNAD
EKLDPASLTKLMTSYVVGQALKAGKIHLTDMVTIGKDAWATGNPVLRGSSLMFLKPGDKV
SVEDLNKGVIIQSGNDASIAIADYVAGSQDSFVSLMNNYAQKLKLTNTTFKTVHGLDAPG
QYSTARDMALLGQALIHDVPDEYAVHKEKEFTFNNIKQPNRNRLLWSSNLNVDGMKTGTT
EGAGYNLVASATSGDMRLISVVLGTKTDRIRFNESEKLLTWGFRFFETVTPIKPDATFVT
QRVWFGDKSEVNLGAGEGGSVTIPRGQLKNLKASFTLNEPQLTAPLKKGQAVGTIDFQLN
GKSIEQRPLLVMEPVEEGGFFSRMWDFVLMKLHGWFGSWFS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcttgcaaatgcctgcaacactacgtggtttagtcgcagggacaaccctgcta
ctgatagcggctcctgcgctgagcgctgagcagaccgcagatgctccccaggtcgatgcc
aaagcctggattttgatggattacgccagcgggaaggtgctggcggaaggaaatgccgac
gaaaagctcgatccggcaagtctgaccaagctgatgaccagttacgtggtagggcaggcg
ctgaaagcaggcaagattcacctgacggatatggtgactatcgggaaagatgcctgggcc
accggtaacccggtgctgcgcggctcttcgctgatgttcctgaaaccaggcgataaagtc
tcggtggaagatctgaacaaaggcgtcattattcagtccgggaacgacgccagcatcgcg
attgccgactatgtggcgggcagccaggactcgtttgtcagcctgatgaacaactacgcg
cagaagctcaagctgaccaacaccacctttaaaaccgttcacggtctggatgctccgggg
cagtacagcaccgcgcgcgacatggcgctgctgggccaggcgctgatccatgacgtgccg
gacgagtacgcggtacacaaagaaaaagagttcacctttaacaatatcaagcagccgaac
cgcaaccgcctgctgtggagttccaacctcaacgttgacggcatgaagaccggcaccacc
gagggtgcgggctataacctggtcgcttcggcaacgtccggtgatatgcgcctgatttcc
gtggtgctgggcacgaaaaccgaccgcattcgctttaacgagagcgaaaagctgctgacc
tggggcttccgcttcttcgaaaccgtaacgccaatcaaacctgacgcgactttcgtgacc
cagcgcgtctggtttggcgataagagcgaagtcaatctgggggcgggtgagggcggttcg
gtgaccattcctcgcggtcagctgaaaaacctgaaagccagctttacgctgaacgaacct
cagctaaccgcgccgctgaaaaagggccaggccgtcggcactatcgacttccagctcaac
ggcaaatccattgaacagcgcccgctgctggtgatggagccggttgaagagggcggcttc
ttcagccgcatgtgggactttgtgctgatgaagctccacggttggttcgggagctggttc
tcttaa

DBGET integrated database retrieval system