KEGG   Cyanobacterium endosymbiont of Epithemia turgida: ETSB_0225Help
Entry
ETSB_0225         CDS       T03622                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ceo  Cyanobacterium endosymbiont of Epithemia turgida
Pathway
ceo00564  Glycerophospholipid metabolism
ceo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ceo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ETSB_0225 (glpD)
Enzymes [BR:ceo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ETSB_0225 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 Thi4 NAD_binding_8 GIDA
Motif
Other DBs
NCBI-ProteinID: BAP17111
UniProt: A0A077JE78
LinkDB All DBs
Position
complement(360623..362302)
Genome map
AA seq 559 aa AA seqDB search
MIMRDFNEIQQTTYDLIIIGGGVNGAGVARDAALRGLKTILIEKGDFACGASSWSTRLIH
GGLRYLEYLEFSLVRESLREREILLRTAPHLVKPLLLTIPIYRDRSRPYWKIWAGMILYD
ILSADKTVPSHRMLPSAQFKQLFPSIDPDGLAGGAQYYDAQVTYAERLCLENILSAKAAG
ATVFSYVEVIHLHRQGNRITSLTCKDYWTDQEFIVNGHDKSIVINMVGPWVDHICRLGMK
DSREAPIGKTKKIGGTKGSHIVVKPFVGALNTSLYVEAKSDGRPFFIVPWDGMYLIGTTD
QPFKGSLEQLKADNDEIDYLLRETNNIIPNARLSRKDIQFTYSGVRPLPNVEGKNTGSIT
RKHIFFDHTKEGVTNLISLIGGKLTTYRQVGEEVVDMVFKRQGKPVPPCPTEDKPLPGSI
LPSDFRVQKVLTEYHDRVSNQTIDHLLSMYGAKTLDILALTDSEPDLAAVIVPELPDIKA
QIVYAVRHELAYTLVDIMRRRTTLAIHSDYGIDLLPSLIETLSRHCSWDEDKCRQEKERY
IDYIQNNCIPDFTSLKKSW
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgcgagattttaatgaaattcaacaaacaacttacgacctgattatcatcggt
ggcggtgtcaatggtgccggtgtagctcgagatgctgctttacgaggattaaaaacaatt
ctcatagagaaaggggattttgcttgtggagcctctagctggtcaacccgtttgattcac
ggagggttgcgctacctagaatacttggaattctccctagtgcgagaatccctaagagaa
cgagaaattctccttcgtactgcccctcatctagttaaacctttattgttaaccattccc
atttaccgtgatcgctctcgtccttattggaaaatttgggcgggaatgatactttatgat
attttaagtgcggataaaacagttccttctcatcgaatgttaccttctgcccaatttaaa
caactttttccctctatcgatccagatgggttagctggaggagctcaatattatgacgct
caagtaacttatgcagaaagattgtgtttagaaaatattctctcggcaaaagcggccgga
gcgacggtttttagttacgttgaagtgattcacttacaccgtcagggcaatagaattaca
tctctgacctgtaaagactattggacagaccaggaatttatcgttaatggacatgacaaa
tcgatagtgattaacatggtaggcccttgggttgatcatatctgtcggttggggatgaaa
gatagcagagaggcccccattggtaaaacaaagaaaattggtggaacaaaaggtagtcat
attgtagttaaaccctttgttggggcactcaataccagtctttatgtagaggctaaatct
gatggtcgtcccttctttattgtaccttgggacgggatgtatttaattggaactactgac
caaccatttaaagggagtctagagcaactcaaagccgacaatgatgaaattgactattta
ttgagggaaactaataatattattcccaacgctcgactttcgcgtaaagacatacagttt
acttattcaggagtacgtcctcttcctaatgttgaaggtaaaaacacagggagtattacc
cgcaaacacatcttctttgatcacactaaagaaggagtaactaacctaatttctttaatt
ggaggaaaattaaccacttatcgccaagtgggcgaagaagtagtcgatatggtctttaag
cgacaaggaaaacctgtccccccttgtccgacagaagataaacctcttccaggctcgatt
ctaccgagtgatttccgtgtacaaaaagttttaacggaatatcatgatcgcgtttcgaac
cagaccatcgatcatttgttatccatgtatggagcaaaaacactagatattttagcgtta
acagactcagaaccggatttggcagcagttattgttcctgaacttcccgatatcaaagcc
caaattgtttatgcagttcgtcatgaactagcttacactttagtagatattatgcgtcgt
cgtactactcttgctatacactctgattatggaatcgatttactgccaagtcttatagag
actctgagtcgacattgtagttgggacgaagataaatgtcgtcaagaaaaagagagatac
attgactatatacaaaataattgtattcctgattttacttctttaaagaaatcttggtag

DBGET integrated database retrieval system