KEGG   Cyanobacterium endosymbiont of Epithemia turgida: ETSB_0392Help
Entry
ETSB_0392         CDS       T03622                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ceo  Cyanobacterium endosymbiont of Epithemia turgida
Pathway
ceo00970  Aminoacyl-tRNA biosynthesis
ceo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ceo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ETSB_0392 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ceo03029]
    ETSB_0392 (gatB)
Enzymes [BR:ceo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     ETSB_0392 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     ETSB_0392 (gatB)
Mitochondrial biogenesis [BR:ceo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ETSB_0392 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: BAP17253
UniProt: A0A077JHR1
LinkDB All DBs
Position
618784..620271
Genome map
AA seq 495 aa AA seqDB search
MTTATPIQTEYEAVIGLETHCQLNTSSKIFCTCSTKFDSPPNTNICPVCLGYPGVLPVLN
KEVVTSAGRLGLAIDGKIALYNKFDRKQYFYADLPKNYQISQYDLPIVEHGSLEIELVDK
KNKEVTRKIIGITRLHMEEDAGKLVHAGSDRLSGSTHSLVDFNRTGIPLLEIVSEPDLRS
GREAAEYAQELRRLVRYLGISDGNMQEGSLRCDVNISVRPMGQKEFGTKIEIKNMNSFNA
IQKAIEYEIKRQIETLERGELLFQETRLWEEKNQCTVSMRKKEGASDYRYFPEPDIPPLE
ISPEQLENWRKTIPELPAQKRKRYEKKLGISAYDARVITDDLNIADFYEKAVETGADAKL
VANWVTQDIAAYLNNSKLDITEIALKPVNLGELIRLIEKEIISGKIAKEILPELLEKGGS
PEKLVKAKGITQISDIKEIEKIIDEILLANPNELEKFRNGKPKLKSFFIGQVMKKTGGRA
DPKLTNQLVEKKLKD
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgactactgcaacccccattcaaactgaatacgaagccgttatcgggttagaaacccat
tgtcaacttaacaccagcagtaaaattttctgcacctgttcaactaaatttgacagtcct
cccaacactaatatttgtccggtttgtttgggctatccgggggttttgcctgtcctcaac
aaagaagttgtaacctctgcgggtaggttagggctagcaatcgatggaaaaattgctctg
tataataaatttgaccgtaaacaatatttttacgctgatctacccaagaattaccaaatt
tctcaatacgatcttcccatcgttgaacacggttctcttgaaattgaattagtggacaaa
aaaaacaaagaagttacccgtaaaattattggtataactcgtttacacatggaagaagat
gccggaaaattagttcacgcaggaagtgatcgtctatcaggatcaactcactctttagta
gactttaaccggacaggtattcctttacttgaaattgtttcagaacctgacttgcgctca
ggacgagaggcagcagaatacgcccaagagttacgtcgtttagtccgttatttaggcatc
agtgatggtaacatgcaagagggttccttgcgttgtgatgttaatatttctgttcgtcct
atgggacaaaaagagtttggaaccaagatagaaataaaaaatatgaattctttcaatgcc
atccaaaaggctattgaatacgaaattaaacggcaaattgagaccttagaaaggggtgaa
ttgctattccaagaaactcgtctttgggaagagaaaaatcagtgtaccgttagtatgagg
aaaaaagaaggagctagtgactatcgttactttcccgaacctgatattcctcccttagag
atatctcccgaacaattagaaaattggcgaaaaactattcccgaacttcctgctcaaaaa
cggaaacgttatgagaaaaaattaggaatttctgcttatgatgctcgtgttataactgat
gatctaaatatagccgatttttatgaaaaagctgtagagactggggctgatgctaagtta
gtggctaattgggtaacccaagatattgccgcctatttaaataatagtaagttagacata
actgaaattgccttgaaaccagttaatttaggggagttaatacgacttattgaaaaggaa
atcattagtggtaaaattgcaaaagaaatccttccagaactattagaaaaaggtggatca
ccagaaaaattagttaaggctaaagggattacccaaatttctgatataaaagaaattgaa
aaaatcattgatgaaatattgttggctaaccctaacgaacttgaaaagttccgcaatgga
aaacctaagttaaaaagtttttttatcggtcaagtaatgaaaaaaacaggtggacgggcc
gatcctaaattaacaaatcagttagtggaaaaaaaattgaaagactag

DBGET integrated database retrieval system