KEGG   Cyanobacterium endosymbiont of Epithemia turgida: ETSB_0466Help
Entry
ETSB_0466         CDS       T03622                                 

Gene name
pdhC
Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ceo  Cyanobacterium endosymbiont of Epithemia turgida
Pathway
ceo00010  Glycolysis / Gluconeogenesis
ceo00020  Citrate cycle (TCA cycle)
ceo00620  Pyruvate metabolism
ceo01100  Metabolic pathways
ceo01110  Biosynthesis of secondary metabolites
ceo01120  Microbial metabolism in diverse environments
ceo01130  Biosynthesis of antibiotics
ceo01200  Carbon metabolism
Module
ceo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ceo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETSB_0466 (pdhC)
   00020 Citrate cycle (TCA cycle)
    ETSB_0466 (pdhC)
   00620 Pyruvate metabolism
    ETSB_0466 (pdhC)
Enzymes [BR:ceo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ETSB_0466 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase DUF4139 GCV_H
Motif
Other DBs
NCBI-ProteinID: BAP17319
UniProt: A0A077JC77
LinkDB All DBs
Position
728901..730199
Genome map
AA seq 432 aa AA seqDB search
MIHDIFMPALSSTMTEGKIVSWLKSPGDKVKKGETVVVVESDKADMDVESFYEGYLATIL
VEAGKEALVGTAIALVAETKAEIAQAQQKALSSPEQTLQTPSTVASISTLELATTPTTTF
STNASKTDESRGTNGRIIASPRAKKLAKQLGIELTTIQGSGPYGRIVAEDVERTTGKPQT
ATITPTSSSASQSTTTPNTSPTPVTVILEETIPLTTLQKAVVQNMVATVQVPTYHVAYTI
TTDSLDKLYKIIKSKGVTMTALLAKAVAVTLHKHPLLNASYSNQGGIHYNRSVNVALAVA
MPDGGLITPVLQNADKIDIYSLSRTWKDLVERARKKQLQPQEYQNGTITISNLGMFGVDH
FDAILPPGQGAILAIGKSRLQVVATPEGLTGVKSQMTVNITCDHRVIYGAHAAAFLQDLA
QLIETDVKLLTM
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgatatcttcatgcctgcactcagttctaccatgaccgagggaaagatcgtc
tcttggttgaagtctccaggggataaagtaaaaaaaggagaaactgttgttgtagttgaa
tcagataaagcggatatggatgtggaatctttctatgagggttatctagcaaccattttg
gtagaggctggaaaagaagctctcgtaggaacagcaattgccctcgtggcagagaccaaa
gcagaaattgctcaagcacagcaaaaagctctctcaagcccagagcaaactcttcaaact
ccctcaactgtagcctcaatctccactcttgaactagctacgacaccaacaacaactttt
tcgacgaatgcttccaaaaccgatgaaagtcgtggcactaatggccgtataattgcctca
ccacgagcgaagaaactagctaaacaattaggtattgagctcacaactattcagggcagt
ggaccttatggacgcattgttgcagaagatgtagaacgcacgacggggaaaccccaaact
gcaactattaccccgacttcatcttctgcatctcaatcgactaccactccgaatacgtcg
ccgactcctgtaactgttattttagaagaaactattccccttactaccttacaaaaagca
gtagtacaaaatatggtagcgacagtacaagttcctacctatcatgtagcttatacaata
actaccgatagtttagataaactctataagataattaaatctaaaggggtaactatgacg
gctttattagcaaaagcagtggctgttacccttcacaaacatcctttacttaacgctagt
tacagcaaccaaggaggaatccactataataggtcagttaacgttgctttagcagtagca
atgcccgatggaggactaattactcctgttctacagaatgctgataaaatcgatatttat
tctctatctcgtacttggaaagatttagtcgaacgcgctagaaagaaacaattacaaccc
caagaatatcaaaacggaactattaccatctcaaatttaggaatgtttggggtagaccat
ttcgatgcaattttacctccaggacaaggagcaattttagctattggtaaatctcgtctc
caagtagtagctactccagaaggattgactggagtaaaaagtcaaatgacagtcaatatc
acttgcgatcatagggtaatttatggggcccatgcagctgcgtttttgcaagatttagct
caattaatcgaaactgatgtcaaattactaaccatgtga

DBGET integrated database retrieval system