KEGG   Cyanobacterium endosymbiont of Epithemia turgida: ETSB_0784Help
Entry
ETSB_0784         CDS       T03622                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ceo  Cyanobacterium endosymbiont of Epithemia turgida
Pathway
ceo00620  Pyruvate metabolism
ceo00680  Methane metabolism
ceo00710  Carbon fixation in photosynthetic organisms
ceo01100  Metabolic pathways
ceo01120  Microbial metabolism in diverse environments
ceo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ceo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ETSB_0784 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ETSB_0784 (ppc)
   00680 Methane metabolism
    ETSB_0784 (ppc)
Enzymes [BR:ceo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ETSB_0784 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PRESAN
Motif
Other DBs
NCBI-ProteinID: BAP17602
UniProt: A0A077JFB9
LinkDB All DBs
Position
complement(1151837..1154872)
Genome map
AA seq 1011 aa AA seqDB search
MVGDINVFSTSDLFLRHRLKLVEDLWEAVLKAECGQELVDLLKQLRTMCSPEGQVTSIPE
ASITELIERLELNEAIRAARAFALYFQLINIVEQHYEQREQQLIRRATCAGNENKSPNKQ
EKEIYGPSKQVNFLEKRFEGDIVSDKAGTFHWLFPLLKQLNVPPQQVQRLLNQLDIRLIF
TAHPTEIVRHTIRRKQQRIVGILQRLDQAEESFRGMGLNNSWEAQTAKEQLTEEIRLWWR
TDELHQFKPSVLDEVDYALHYFDEVLFDALPQLSKRLQRALKSSFPWLHPPRSTFCRFGS
WVGGDRDGNPFVTPEVTWQTACYQRNLVLEKYLHSIENLTELLSVSLHWSNVSQDLLDAL
ELDRSAMPEIYEQLAIRYRHEPYRLKLSYIQKRLENTRDRNDRLANPEQRQLLSSLTGQN
IYHSGTEFWQDLELIKRNLEETGLNCQELENLLFQAEIFGFTLTQLDFRQDSSRHSDAIE
EIAEYLDILPQPYNQLPEEEKVKWLIQELGTRRPLIPTGMQFKKAEHSETLETMRMLRYL
QQEFGLEICQTYIISMTNYVSDVLEVLLLAKEAGLYDPAISTTTIRIVPLFETVDDLKRA
PQVMGDLFQLPLYRAALAGGYDQLQCSNNSNKPTPVSLSALQPTNLQEIMVGYSDSNKDS
GFLSSNWEIHKAQKALQKVAQPHGIDLRLFHGRGGSVGRGGGPAYAAILAQPTSTINGRI
KITEQGEVLASKYSLPELALYNLETATTAVIQSSLLGSGFDDITSWNGIMDELAKTARKA
YRALIYEQPDFLDFFLSVTPIPEISQLQISSRPARRKSGIKDLSSLRAIPWVFSWTQSRF
LLPAWYGVGTALQSFRDRETEENLKLLRYFYLKWPFFKMVVSKVEMTLSKVDLQIAHHYV
RELSKPEDIERFNRVFKQISQEYYLTRDIILSITKHQKLLDGDVGLQRSVQLRNGTIVPL
GFLQVSLLKRLRQYTHQSESGVVHFRYSKEELLRGALLTINGIAAGMRNTG
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atggtcggagacattaacgttttttcgacttccgacttatttttacgtcaccgtctcaaa
cttgttgaagatttatgggaggcggtgttaaaagctgaatgtggtcaggaattggtagat
ttactaaaacaacttcgtacgatgtgttctcctgagggacaggtgacaagtatccctgaa
gcctcgatcaccgagcttattgaacgattagaacttaatgaagcgattcgggcagctaga
gcatttgctctttattttcaactaattaacattgttgagcaacattacgaacaacgagag
caacagttgataagacgcgcgacctgtgccggaaatgaaaataaatctccaaataaacag
gaaaaagaaatctacggcccatcaaaacaggtaaactttttagaaaaacgttttgaaggt
gatattgtctctgataaagctggaacttttcactggttattccctctattaaaacaactt
aatgttccgccccaacaagttcaacggctgcttaatcaacttgacatccgtctaattttt
acagcccaccctactgaaattgttcgccatacgatccgacgtaaacaacagcgtattgtg
ggcattctacaacgcttggatcaagctgaagaatcgtttcgggggatgggactgaacaac
tcttgggaagctcaaaccgctaaggaacaactcacagaagaaatccgtctttggtggcgc
actgatgaacttcaccaatttaaacccagtgttctcgatgaagtggactatgccctccac
tacttcgatgaagtcttatttgatgccctaccccaactgtctaaacgattacaacgagcc
ttgaagtcgtcttttccctggttacatcctccccgtagtaccttttgtcgtttcggttct
tgggtcgggggtgatcgtgatggcaacccctttgttaccccagaagtaacttggcagaca
gcctgttatcagcgcaacttggtgttggagaagtatttgcactctattgagaatttaaca
gaactgttaagtgtttccctccactggagcaatgtttcccaagacttacttgatgcccta
gaacttgaccgctcagccatgccagagatttatgaacaactggctatccgttaccggcac
gaaccctatcgtttaaaattatcttatattcaaaaacgattagaaaatacccgtgaccgc
aatgatcgtttggcaaacccagaacaaagacaattgctttctagtctgacgggacagaat
atttatcattcgggaacagagttttggcaagatttagaactcattaaacgaaatcttgaa
gaaaccggactcaattgtcaagaactcgaaaacttactctttcaagccgaaatatttggc
tttaccctgacgcagttagactttcgtcaagactcctcccgtcattctgatgctatagaa
gaaattgccgaatacttagatattctgcctcaaccatataaccagcttcccgaagaagag
aaagtgaagtggttgatacaagaactaggtaccagacggcccttaattcccacagggatg
cagtttaaaaaagccgagcacagtgaaactctcgaaactatgcggatgttgcgctacctg
caacaagagtttggcttagaaatctgccaaacctacattatcagtatgactaactatgtc
agcgatgttctagaagtcctattgttagcaaaagaagcaggactttatgatccagcaatt
agtacaactaccattcgcattgtgcctttgtttgaaacggtagacgacttaaaacgtgct
ccacaagtgatgggagatttattccaattacccctgtatcgtgcagctttggcgggtgga
tacgatcaacttcaatgctctaataactcgaacaagcccacccctgtgtctctttcggca
ttacaaccgactaacctgcaagagatcatggtggggtattccgacagtaacaaagattca
gggtttctcagcagtaactgggaaatccacaaagctcaaaaagccctacaaaaagtggct
caacctcatggtattgatttaagattgtttcatggacggggtggatcagtagggcgaggg
ggcggtcctgcctatgcggcaattttagctcaacctacttctaccattaacggacgaatt
aaaattacggaacaaggagaagtgttagcttctaagtattcccttcctgaattagccttg
tataacctagaaaccgccaccactgccgtgattcagtcgagtttattaggaagtggtttt
gatgatatcacctcttggaatggaattatggacgagttagctaaaactgctagaaaagcc
tatcgggcgctaatttacgaacagccagattttttagatttcttcttgtcagtaactccc
attcctgaaattagccaattgcaaattagttctcgtcccgcacgacgcaaaagcggtata
aaagatctgagtagcttacgcgctattccttgggtgtttagttggactcagagtcgtttt
cttttaccagcttggtatggagtaggaaccgctctacaaagttttcgagatcgagaaaca
gaagaaaatctgaagttattgcgatatttttacctcaagtggccgtttttcaaaatggta
gtttctaaagttgaaatgaccctatctaaggtagatttacaaattgctcatcattatgta
agagaattatctaaacccgaagatatagagcgatttaatcgagtttttaaacaaatatct
caagaatattacctaactcgtgatattattctctctattaccaagcaccaaaaattactc
gatggtgatgtcgggctacaacgttcggttcagttacgcaatggaaccattgttcctcta
ggatttttacaagtttctctcttaaagcggttgcgtcaatatactcatcagtccgaatct
ggggtagttcatttccgctattctaaggaggaattactacggggagcgttgttaacaatt
aatggaattgctgcaggaatgaggaacacaggatga

DBGET integrated database retrieval system